SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra005123 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra005123
Domain Number 1 Region: 720-903
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000104
Family Tetratricopeptide repeat (TPR) 0.0078
Further Details:      
 
Domain Number 2 Region: 537-571,630-765
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000304
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 
Domain Number 3 Region: 407-443,492-571
Classification Level Classification E-value
Superfamily TPR-like 0.00000000253
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Domain Number 4 Region: 197-302
Classification Level Classification E-value
Superfamily POZ domain 0.0000000479
Family BTB/POZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra005123
Sequence length 913
Sequence
MQPNLFTTMRSLKLIEGCKATQVYPSSSPPPPPSTGLREKLLHHLQDHFRVNSTRSKPSH
THQNASVSSDSLLLPHGLPVSDLLEPHIDPSLRFVDSIEKLAEVHRRIENCPNLEKSEAF
LEQCAIFRGLTDPKLFRRSLRYERREDELIGTTSMDCCGRNLGCPNMSLVSGYDPESVYN
RCLCSRSETNGGDCVSECSTCDVDYDMSFCIGDEEVRCVRYKIASLSRPFKVMLYGGFRE
TRLSAINFALNGVSVEGMRAAEAFSRIHKVEIFSVNIVLELLTLANRFCCDELKAACDSH
LSRLVKDLDDALLLIEYGLEEAAYLLVAACVQVFLRELPSSMRNPNVVKIFCSVEGRERL
GLVGHGSFVLYLFLSQIAMEDDMKSNTTVMMLECLVEYAVEAWQKQLACHQLGAVMLERK
EYKDAERWFSSAVEAGHVYSLVGVARSKFKRGHRYSAYKIMNSLISDCSAATGWMHQERS
LYCSGKEKLLDLDMATDLDPTLTFPYMFRAVSLSEESQFGAAVAELNKIMGFKVSPDCLE
MRAWISIAMEDYEGALKDIRALLTLEPNFLMFNKKIHGDHMVELLRPLVQQWNQADCWMQ
LYDRWSSVDDIGSLAVVHHMLANDPGKSLLRFRQSLLLLRLNCQKAAMRSLRLARNHSKS
EHERLVYEGWILYDTGHREEALAKAEESISIQRSFEAYFLKAYALADSALDPESSKYVIQ
LLEEALRCPSDGLRKGQALNNLGSVYVDCDKLDLAADCYTNALNIKHTRAHQGLARVYHL
KHQRKWAYDEMTKLIEKARNNASAFEKRSEYCDREMAQSDLGMATLLDPLRTYPYRYRAA
VLMDDHKETEAIEELSKALAFKPDLQLLHLRAAFYDSMGKSAEAIRDCEAALSLDPNHTD
TIDLYNKAREPQP
Download sequence
Identical sequences M4CLN6
Bra005123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]