SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra005710 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra005710
Domain Number 1 Region: 216-320
Classification Level Classification E-value
Superfamily TPR-like 0.00000228
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Weak hits

Sequence:  Bra005710
Domain Number - Region: 78-194,240-289
Classification Level Classification E-value
Superfamily ARM repeat 0.0483
Family Clathrin adaptor core protein 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra005710
Sequence length 422
Sequence
MIHTATKCARAAAATVRGGAIPVRSSLVRYATPLRLIHGEISVPNANNVAIQMVNYALSH
ARSQRSDESYAQGMLVLEQCLGNQASDDQVSQDSKATVLLAMSDLLYESGNSSEAIERLK
QVMSLTLSSLSIRVVAVEALVGLLIQSGQDDASLNVADEFLELVKERGHENLQGVAATAK
TIKGLTELVKGSIESAESLFQGLENHEICKGSNIALSYGEFLHATGNFEMAKEMYQKAIQ
GVTETKESMSSCNMNLKAVSLAATFALGQLESHIGNFGDAEETLTSALTSAEAHYGHSHP
KVGVILTGVALMYRNKAKQERSSSIMIQEGLFRRALELMKAPPLDDTEGIINVETQEVMA
LARGGYAGLLLIQENRRSEGEKMKSWAESAWRNRRISLSEALTLSEPLGKVGIIDARTTR
VL
Download sequence
Identical sequences M4CNC2
Bra005710 XP_009130683.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]