SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra006029 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra006029
Domain Number 1 Region: 62-292
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.96e-84
Family Inorganic pyrophosphatase 0.000000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra006029
Sequence length 296
Sequence
MAATRVITAASATTSCFLAKRAFVLPAKRSCGGGALCFSRRAFVLKSKRPFSCSAIYNPQ
VKVKEEGQPETLDYRVFFLDGSGKKVSPWHDIPLTLGDGVYNFIVEIPKESKAKMEVATD
EDFTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPSQANAEVEGAFGDNDPVDVVEIGE
TQRKIGEVLKIKPLAALAMIDEGELDWKIVAISLDDPKAHLVNDVDDVEKHFPGTLTAIR
DWFRDYKIPDGKPANRFGLGDKPANKEYALKIIHETNESWAKLVKRSVDAGDLSLF
Download sequence
Identical sequences M4CP91
XP_009131119.1.100322 Bra006029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]