SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra006287 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra006287
Domain Number 1 Region: 339-532,559-611
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.67e-74
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00000107
Further Details:      
 
Domain Number 2 Region: 146-363
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.78e-58
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00019
Further Details:      
 
Domain Number 3 Region: 18-110
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000845
Family FHA domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra006287
Sequence length 612
Sequence
MASSQVAYLIPLKPDLKEDNSSPRITLSEGPNTIGRLNVSTTDKRLSRKHITITPSASGS
ASLSVEGTNPVVVRSSGERKKVNPRGEVSLANDDLIELIPGHHFFKLVLPRESERGSYER
AAKKARKEGDDVEAIRSFCPDSEKLPSTFRLLSVDGLPDWANTSCVSINDVVEGDVVAAV
LSNYMVDLDWLLSACPKLVNIPQVMVVHGEGDGRQEYIQRKKPANWILHKPRLPISFGTH
HSKAIFLVYPRGVRVVVHTANLIHVDWNNKSQGLWMQDFPWKSDDDNIDTPKVCGFEDDL
VDYLAVLKWPEFTACLPGRGNVKINAAFFRKFDYSSATVRLIASVPGYHTGSNMRKWGHM
KLRTILQECIFDREFRRSPLVYQFSSLGSLDEKWLAEFGASLSSGITEDRTPLGHGDPLI
IWPTVEDVRCSLEGYAAGNAIPSPLKNVEKPFLKKYWAKWKADHSARSRAMPHIKTFTRY
SDQKIAWFLLTSSNLSKAAWGALQKNNSQLMIRSYELGVLFLPSPVKTQACNFSCTDNNS
STKKVKQETKGEVEKRSKLVTMTWQGDRDSPEIISLPVPYQLPPEPYSSEDVPWSWDRGY
SKKDVYGQVWPR
Download sequence
Identical sequences M4CPZ8
Bra006287 XP_009131446.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]