SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra006875 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra006875
Domain Number 1 Region: 747-931
Classification Level Classification E-value
Superfamily TPR-like 6.13e-16
Family Tetratricopeptide repeat (TPR) 0.0089
Further Details:      
 
Domain Number 2 Region: 433-476,509-596,635-679
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000683
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 3 Region: 228-327
Classification Level Classification E-value
Superfamily POZ domain 0.0000000659
Family BTB/POZ domain 0.023
Further Details:      
 
Weak hits

Sequence:  Bra006875
Domain Number - Region: 659-733
Classification Level Classification E-value
Superfamily TPR-like 0.00696
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Domain Number - Region: 324-392
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0137
Family BCR-homology GTPase activation domain (BH-domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra006875
Sequence length 941
Sequence
MQHQHNLFTTMRSLNLAEGCKGTQVYAPPPPPQPNNNATGGVGDKFLQHLQVHLRVNSIR
SKSSRTYPQANVVVSPESLLPFGLPLTDLLEPRIDPSLKFPDLVDKMAQVYRRIDNCDQS
ERSGAYLEQCAVFKGLSDPKLFRRSLRSSRQHAIDVHAKVVLSSWLRFERREDELIGTTS
MDCCGRILECPKATLVTGYDPETVYDPCLCSGGASDEVQECSTSEEALDYDMSFCIGDEE
VRCVRYKIASLSRPFKAMLYGGFNEMKRGTINFTHNGISVEGMRAAEIFSRTKRLDDFPP
HVVLELLKLANRFCCDEMKSSCDEHLAHLVGTLDEAMLLIEYGLEESAYLLVAACLQVFL
RELPSSMHNPNVIKIFCSVEGRERLASLGHASFKLYFFLSQIAMEDDMKSNTTVMILERL
VECAVESWEKQLACHQLGVVMLERKEYKDAQRWFNTAVEAGHLYSLVGVARSKFKRDHRY
SAYKIINSLISDHVPTGWMHQERSLYCSGKEKLLDLDTATELDPTLTFPYKFRAVALVEE
NQFGAAISELNKILGFKASPDCLEMRAWISIGKEDYEGALKDIRALLTLEPNFMMFNGKI
HADHMVELLRPLAQQRSQADCWMQLFDHWSTVDDIGSLAVVHDMLANDPGNSLLRFRQSL
LLLRLNCQKAAMRCLRLARNHSKLKHERLVYEGWILYDTGHREEALAKAEESISTQRSFE
AFFLKAYALADSTLDPKSAEYVIQLLEEALRCPSDALRKGQALNNLGSVYVDCEKLDLAG
DCYTNALNIKHTRAHQGLARVYHLKNQRKAAYDEMTKLIEKAQNNASAYEKRSEYCDREM
AQSDLSLATQLDPLRTYPYRYRAAVLMDDHKENEAIEELSRAISFKPDLQLLHLRAAFYD
SMGEGASAIKDCEAALCIDPGHTDTLELYHKAREANTTDQK
Download sequence
Identical sequences M4CRN4
Bra006875 XP_009115879.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]