SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra007011 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra007011
Domain Number 1 Region: 115-191,233-297
Classification Level Classification E-value
Superfamily TPR-like 5.96e-19
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra007011
Sequence length 323
Sequence
MYSLGRLQLHHQPAHLPFTHTSSSFPKQSSLSIRPNPSFKYPSLQASSSSKPQNFILIPL
QKSAPFRFLKSTCITLTTAAALLSLKPPAIAAPVRPPTTMEEKEKALEEQLAAHPHDVDT
LRSLMEAKFRSGEFTDAIKLTDRLIKLEPDEPKWPVQKAKCFLYSGDKESAKSVYQEILA
KDPLRPEAHHGLCMASSDEGLDWKKVESIIEEAMLSCRKENRHKEYRGFKLLMAQIRVVR
GKHGEALKLYEELAEEEPGDFWPYFCQGAIYTLLNKEDKAEEQYLKFKKLVPENYNYIED
FLVSNLFAGELFSAMERRSGSKS
Download sequence
Identical sequences M4CS19
XP_009116051.1.100322 Bra007011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]