SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra007016 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra007016
Domain Number 1 Region: 31-213
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.09e-67
Family Inorganic pyrophosphatase 0.00000578
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra007016
Sequence length 217
Sequence
MAPPIEIAATKSYAEKQVSLPLLNERILSSMTHRSVAAHPWHDLEIGPEAPIIFNCVVEI
GKGGKVKEELDKTTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPIDVLVIMQEPVIPG
CFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKN
ENKEVAVNDFLPATAAYEAVQHSMDLYADYVMETLRR
Download sequence
Identical sequences M4CS24
XP_009116059.1.100322 XP_018510398.1.100322 Bra007016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]