SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra007122 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra007122
Domain Number 1 Region: 298-509,685-710
Classification Level Classification E-value
Superfamily TPR-like 0.0000000307
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 
Domain Number 2 Region: 163-260
Classification Level Classification E-value
Superfamily HCP-like 0.0000235
Family HCP-like 0.02
Further Details:      
 
Weak hits

Sequence:  Bra007122
Domain Number - Region: 611-710
Classification Level Classification E-value
Superfamily TPR-like 0.00133
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra007122
Sequence length 844
Sequence
MRSLLAFRKIPPPFLLRCLIHCKPFCSQSRFPTESDNPSPQVNENPPTSSSSVVVVANLS
TRKPEHKDESRVIDALLDRRNDPESALRFYNWARPGSFEVGDSFWLLIHILVSSPESHGR
ARDLLQRYVSSSSPMPRVLVCNLVESAKSFGFEVKALPFSYLLNAYTKERRTDCAVECIK
LMIELGLAPYVRYVNNTLSALVRRNSINEAKELYGKMVATGLVAGDKATAHLLMRASLRE
EKPEEALEVFSKAIEREEEPDGLLYSLAIQACCKTVNLGMAFGLLSEMKEKKLCVSQETY
TSVIVALVKQDRVEEAVRLKDEMVSEGIPMSVIAATSLIKGHCKNGDLGSALEMFRKMEK
EGPSPNRVTFSVLIEWFSKSGEMERVLEFYKKMEALGITPSSFQVHSVIQVCLKGQRPEH
GLKLFEEYFETGSANIFICNSMLSWLCKQGKIDETKDLLRKMESRGLGPNVVSYNNVMLA
LCRTKRLDLALTVFSEMLEKDIKPNDYTYSTLIDGCFKNHDFHNAWEIIAQMNSSDIEVN
EVVYHTVINGLCKAGQSSKARDMLEDLMREKRVCVGCMSYNTIIDGFIKESRMDSAVAAY
REMCGNGVSPNVVTYTCMMDGLCKNSRMDQALEMRKEMKEKGLKLDVPAYGALIDGFCKK
GEMKSASALFSELFKEGLNPNKAVYNSLISGFRNLGNMEAAIDLYKKMLKDGLRCDLRTY
TTLVYGLLKEGNLIMAFGLYTEMQGLDIVADEIMCSVIVNGLSKVGQFVEVVKLFEEMKK
NDVTPNVFIYNAVIAGHFKEGNLDEAFRLHDEMLDKGLVPDGVTFDILVRGKYGESQCIG
VESL
Download sequence
Identical sequences M4CSD0
Bra007122 XP_009116195.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]