SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra007201 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra007201
Domain Number 1 Region: 106-414
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.03e-106
Family Mammalian PLC 0.00003
Further Details:      
 
Domain Number 2 Region: 418-545
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.28e-25
Family PLC-like (P variant) 0.0047
Further Details:      
 
Domain Number 3 Region: 23-99
Classification Level Classification E-value
Superfamily EF-hand 0.0000000066
Family EF-hand modules in multidomain proteins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra007201
Sequence length 546
Sequence
MSKQTYKVCFCFRRRYRHTASVAPSEIKTIFDNYSDKGLMTVDHLLRFLTDVQKQDQATR
EEAQAIVNASSSLLHRNGLHLDAFFKYLFSANNSPLAYHEVHQDMDAPLSHYFIFTGHNS
YLTGNQLSSDCSEVPIIDALRKGVRVIELDLWPNSDEDGIDVLHGRTLTSPVELSRCLNA
IQTYAFDVSDYPVVVTLEDHLTPKLQAKVAEMVSEIFGDILFTPPPGECLKEFPSPASLK
KRIIISTKPPKEYKKSTDDEDVVKKDRSLGDEEVWGREVPTFTRKDTSDDKAGKPKGGMV
ECLKVDPDKVRRLSLSEEQLEKASEKYAKQIVRFTQRNMLRIYPKGTRITSSNYNPLVGW
SHGAQMVAFNMQGQGRSLWVMQGMFRANGGCGYIKKPDILLKSDPAFDPEATLPVKTTLR
VTIYMGEGWYYDFPHTHFDRYSPPDFYTRVGIAGVTADTVMRKTKMLEDNWIPDWNEVFE
FPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVWELRQGIRVVPLHNQDGVKCRSVKLL
VRLEFV
Download sequence
Identical sequences M4CSK9
Bra007201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]