SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra007317 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra007317
Domain Number 1 Region: 336-408
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000136
Family PCI domain (PINT motif) 0.083
Further Details:      
 
Weak hits

Sequence:  Bra007317
Domain Number - Region: 110-166
Classification Level Classification E-value
Superfamily TPR-like 0.000518
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra007317
Sequence length 441
Sequence
MAETKENYDLTPRVAPNLDRHLVFPILEFLQERQLYPDEQILKFKIELLNKTNMVDYAMD
IHKSLYHTEDAPQDMVERRAEVVARLKSLEEAAAPLVTFLLNPAAVQELRADKQYNLQML
KERYQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEIL
MQNWDIAFEELNRVKDIIDSKSFASPLNQVQNRIWLMHWGLYIFFNHDNGRTQIIDLFNQ
DKYLNAIQTSAPHLLRYLATAFIVNKRKRPQLKEFIKVIQQEHYSYKDPIVEFLACVFVN
YDFDGAQKKMKECEEVIVNDPFLGKRVENGNFSTVPLRDEFLENARLFIFETYCRIHQRI
DMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSEAGTVIMEPTQPNVHEQLINHTKAL
SGRTYKLVTQLLEHTQGQAAR
Download sequence
Identical sequences M4CSX5
Bra007317 XP_009116433.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]