SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra008417 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra008417
Domain Number - Region: 196-355
Classification Level Classification E-value
Superfamily HCP-like 0.00123
Family HCP-like 0.037
Further Details:      
 
Domain Number - Region: 304-456
Classification Level Classification E-value
Superfamily TPR-like 0.00316
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra008417
Sequence length 784
Sequence
MFLRSVIQFYSKRPYTTEFNISSEVIAILSKAKPIEPALEPLVPFLSHKTITSVIKDHLN
PQLGFRFFIWASRRERLRSKESFSLLIDMLSKENGCDLYWQTLEELKSSGVSVDSYCFLV
LISAYAKMGSAEKAVESFGRMKEFGCRPDVFTYNAVLRVMMRKEVFFMLAFAVYNEMLKC
NCAPNRYTFGVLMDGLYKKGRMNDAQKMFDDMTGRGILPDRVTYTILISGLCQRGSVEDA
RKLFHEMKEAGEAPDSVACNALLDGFCKLGRMVEAFQLLRMFEKDGFVLGLRGCSSLIDG
LFRGGRYDEGFELYEIMLKKNIKPDVVLCTILIQGLSKAGKIEDALKLLSSMPSQGIPPD
TYCYNAVIKALCEQGLLEEARSLHLEMSETESFPDEFTQTILICSMCRNGLVRKAEEIFN
EIEKRGCSPSVPSFNALIDGLCKSGELKEARLLLHKMEVGRPASLFLRLSYSGNRSFDAM
VESGSILKAYKDLAHLADAGNSPDIVTYNVLINGFCKAGDIDGALKLLNVLQLKGLSPDS
VTYNTLINGLHRVGREEEAFKLFYAKDDFRHSPAVYKSLMTWSCRKRKITVAVSLWMKYL
KKISCLDDETANEIEQCFKAGETERALRRLIELDTRREEFSFEPYTIWLIGLCQAGRFQE
ALMVFSVLREKKILVTPPSCVKLIHGLCKREQLDAAVDVFAYTLDNNFKLMPRVCNYLLS
SLLQTRDRVEIVSRLINRMELAGYDVDSMLRFRLLKRLRHRKSRVMIDESVELEAEGKNE
KDQV
Download sequence
Identical sequences M4CW20
Bra008417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]