SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra008515 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra008515
Domain Number 1 Region: 812-1006,1034-1065
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.29e-29
Family Phospholipase D 0.064
Further Details:      
 
Domain Number 2 Region: 1146-1246,1292-1380
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.06e-28
Family Nuclease 0.052
Further Details:      
 
Domain Number 3 Region: 641-786
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.37e-23
Family PLC-like (P variant) 0.03
Further Details:      
 
Domain Number 4 Region: 304-369
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000085
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0027
Further Details:      
 
Domain Number 5 Region: 217-303
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0000000275
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra008515
Sequence length 1450
Sequence
MGGGGGVRLSLLKSLYRSSTRISSSSSSSCRRLAEEAAIVRSSSPVSSFTHARAIGYGYG
SWIVSSSSNLNAKPFPLLARAFSSQPDGTDWVHKAKDVFHETANKAKEASDELTPHVQQL
LDANPYLKEVMVPVSLTMTGTLFAWVVMPKVLRRFHGYSMRSSAALLPQGFAIDDVPYDK
SFWGALEDPARYLMTFIAFAQIASMVAPTTVAAQYFFPALKGAVILSLVWFLHRWKTNVI
TRVLSAKNVAGLDREKILTLDKVSSVGLFAIGLMASAEACGVAVQSILTVGGVGGVATAF
AARDILGNVLSGLSMQFSRPFSMGDTIKAGSVEGQVVEMGLTTTSLLNAEKFPVLVPNSL
FSSQVIVNKSRAQWRAIASKIPLQIDDLDKIPQISDEIKETLRSNPKVFLGKEAPHCYLS
RVEKSFAELTIGCNLKYMGKEELYATQQEVLLESVKIIKKHGPPPPPPNSDPYPPQAYPP
PLHHQYGSMSHSGPLDYAHRPPPPLHHHYGSMSPSGPPPHYSYDHQHQPYPYPPQQPTLQ
PHASFASYPPPPQHPPRPHDNFGSSSPPVYPPLHDLMGALTLSSHHHPPSSNPGSYHGQP
YHSFSTHSHLSHSGRLDSPLPHSPSLQIVPSGKPSLKVLLLHGNLDILIYRANNLPNMDL
FHNTLGAVFGSISNMIEGQLSKKITSDPYVSISVAGAVIGRTYVMSNSENPVWHQHFYVP
VAHHAAEVHFVVKDSDVVGSQLIGLVTIPVEQIHSGARIEGTYSILSSNGKPCKPGATLT
LSIQYTSADKLSVYHSGVGGGPSYQGVPGTHFPLREGGNVTLYQDAHVPEGMLPRIRLGN
GMYYENGKCWDDMFHAICQARRLIYITGWSVWHNVRLARDKGNPASECTLGELLKSKSRE
GVRVLLLVWDDPTSRDILGYKTDGVMGTHDEETRRFFKHSSVQILLCPRNAGKRHSWVKQ
TEVGTIYTHHQKTLIVDADAGGNRRKIVAFVGGLDLCDGRYDTPQHPLFRTLQTDHKGDY
HNPTFTGNLSGCPREPWHDLHSKIDGPAAYDVLTNFEERWLKAAKPHRINKLKTSYDDAL
LRIERIPDILGVFDAPTVSANDPEAWHVQIFRSIDSNSVKGFPKDPKYATSKNLMCGKNV
LIDMSIHTAYVKAIRAAQHFIYIENQYFIGSSYNWNAHKDIGANNLIPMEIALKIADKIR
ANERFAVYIVIPMWPEGVPTGAATQRILYWQHKTMQMMYGTIYNALVEAGLDDKFSPQDY
LNFFCLGNREMVDGNNETNQSNENTPQASCRKSRRFMIYVHSKGMVVDDEYVVIGSANIN
QRSMEGTRDTEIAMGAYQPQHTWARRQSGPRGQIFGYRMSLWAEHMAMLDDSFEEPESLE
CVSKVRRMGEENWKQFRAEQVSEMRGHLLKYPVEVDRRGKVRPLPGSEEFPDVGGNIVGS
FLAIQENLTI
Download sequence
Identical sequences M4CWB8
Bra008515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]