SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra008706 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra008706
Domain Number 1 Region: 167-343
Classification Level Classification E-value
Superfamily TPR-like 0.00000114
Family Tetratricopeptide repeat (TPR) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra008706
Sequence length 537
Sequence
MIRKQTNDRTATRHRPKLWQNCTSLRSLKQIHAFMILNGLMSDLSVVGELIYSASLSIPG
ALTYAHKLFDVIPKLDVSICNHVLRGTSQSMKPAKTVALYKEMEKRGVRPDRYTFTFVLK
ACSRLEWRSNGFAFHGKVMRHGFASNEYVKNALILFHANCGDLEIASELFDDSAKAHKVA
WSSMTSGYAKRGKIDEAIKVFDEMPEKDQVAWNVMITGCLKCRKMEKARELFDRFKEKDV
VTWNAMISGYVSCGFPKEALSIFKEMRDAGEHPDVVTVLSLLSACADLGDSETGRRIHLY
VLETASVSRSMYIGTPVWNALIDMYAKCGSIDSAIQVFRGMRERDLSSWNTLIVGLALHH
AEGSIEMFEEMQRLRVWPNEVTFIGVILACSHSGKVNEGREYFRLMKDVYKIEPNIKHYG
CMVDMLGRAGLLDEAFMFVESMGIEPNAIVWRTLLGACRIYGNVELGKYANEKLLSMRKG
ESGDYMLLSNIYASTGEWERVQKVRKMFDDTGVKKPSGYSLIEEDDDRLMMKYLLSS
Download sequence
Identical sequences M4CWV9
XP_009121586.1.100322 Bra008706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]