SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra008972 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra008972
Domain Number - Region: 178-520
Classification Level Classification E-value
Superfamily TPR-like 0.00569
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra008972
Sequence length 596
Sequence
MNSLFTSFRRILPLNPNSHPHFLLHKFSSSRRSSPRIPIQRLQQPPASPDSTRHQLTVPD
FSQTDLATISKLLENHNVIPGSSLESALNETGIEPSYQLVQALFDRLSSSPMLIHSVFKW
ADTRPGFTLSPPLFNSVINAMCKARDFESAWSLIFDRARSDKGSELVTADTFTVLIRRYA
RAGMVQQAIKAFEYSTSYYDTELKLLEVLLDALCKEGHVTEASMYMERRRRMDSNWIPSV
RIFNILLNGWFRARKLKQAENLWGEMKEMNVKPSVVTYGTLIEGYCRMRRVEVALEVLEQ
MKLEELEMSYMVFNPIIDGLGEAGRLQEALGMMERFFVCVSGPTIVTYNSLVKNFCKAGD
LLGASKILKMMMNRGVDPTPTTYNHFFKYFSKHNKTEEGMNLYFKLIEAGHSPDRFTYHL
IMKMLCEDGKLSLAMQVDKEMKNRGIDPDLLTTTMMIHLLCRLDMFEEAFEEFEKVVRRG
IIPQYITFKMIDNGLRTKGMIEMAKRLASVMSSLPHSEKLPNTYREVVDAPPGRGDRRKS
ILHRAEAMSDVLKGCRNPRKLVKMRGSLKTVVSKDEKVVDDGDAVRVPDEPSSPLS
Download sequence
Identical sequences M4CXM5
Bra008972 XP_009121967.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]