SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra009117 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra009117
Domain Number - Region: 67-169
Classification Level Classification E-value
Superfamily TPR-like 0.0303
Family Tetratricopeptide repeat (TPR) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra009117
Sequence length 453
Sequence
MAKNESGYESLLASLIVDIKSYSGKDHLLPWIRGIKKMKESLPPQILNEKLPRFLQKCAQ
SFESDKRYRNDSRYIRVWLQLMDFVDDPKALLRTMEANSIGTKRSLFYQAYALHYEKLKR
FEDAEKMYRLGVQNLAEPMDELQKSYLQFLSRMERHKRKKTQRQELKVSEKHQKAERSQK
EPRLASKDDTPVLNFVDKAIVGKPEAENACHHGLVDPTINMKEAMNAINSMFKEPIETAP
LQRKSQQRSQDKENQGGFEVFVDKNQGSFEIFVDDENDDETTDENDESGKGFVFLQPRDH
SPESSEEADRNNSPPRARFREDTVVRRFVGSTISEEPAVENVCHHGLVDPTVNLKEAMED
INNMFGEPIDFVRPNRSKNKGKAVVQEKKPDAAAGFSILEDDDDEAEEEHQETNGVTQIS
PRKENERDLFEPTVCTKVALDEINKLFAMPMDF
Download sequence
Identical sequences M4CY20
Bra009117 XP_009122156.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]