SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra009345 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra009345
Domain Number - Region: 41-217
Classification Level Classification E-value
Superfamily TPR-like 0.0164
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra009345
Sequence length 312
Sequence
MFLCMEKDKSVKPNHITVTSVLPACANLGALEIGRRLERYARENGFFDNIYVSNATLEMY
SKCGMIDVAKRIFDELGKQRNLCSWNSMISSLATHGKHDQALELYAQMLREGGKPDAVTF
VGLLLACVHGGMVAKGKELFKSMEEVHKISPKLEHYGCMIDLLGRVGKLQEAYDLIRTMP
MKPDAVVWGTLLGACSFHGNVEIAEIASEALFKLEPSNPGNCVIMSNIYAANERWDGVLK
MRKMMKKETMTKAAGYSYLVEVGVEVHNFTVQDKSHPRSYEIYQVLDEITRRIKPDKSCF
DSKTMTESVELM
Download sequence
Identical sequences M4CYP8
Bra009345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]