SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra009383 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra009383
Domain Number 1 Region: 41-456
Classification Level Classification E-value
Superfamily Amidase signature (AS) enzymes 4.58e-74
Family Amidase signature (AS) enzymes 0.00024
Further Details:      
 
Domain Number 2 Region: 661-919
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.27e-47
Family Carbon-carbon bond hydrolase 0.0081
Further Details:      
 
Domain Number 3 Region: 488-605
Classification Level Classification E-value
Superfamily TPR-like 4.09e-29
Family Tetratricopeptide repeat (TPR) 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra009383
Sequence length 923
Sequence
MSKSLTFIQTNASNPKTWVVIGVTVAGIVILAETRKRRIKALREEHFGAFLDRFELLPFP
PPPPPAAKQTLSGLTFSISDAFDIKDYITGFGSPHWKKTHEAAEKTAVVVTTLLRNGATC
VAKTVMDEMGFGITGENMHYGTPINPLMPSNVPGGCSSGSAVSVAAELVDFALGIDTTGG
VRIPASFCGILAFRPSQGTVSSVGVLPNSQSLETAGWFARDPSVLCQVGHALLNLSAVTH
KRQRSLIFADDLFELTDVPKQKSVHVVRKAIENLPGYQAPKHMNVGQYVASNVPSLAEFC
EKPGKSEDSASTLKALASVMLSIQRHEFKTNHEEWSQTCKSFLGPRFSNDVVAALKSRNE
NIKSLYRVKTEMRATIQSLLKEDGILVIPTVADPPPKLNTKNKNAMNEFLDRNYALASIA
SMSGCCQVTVPLGKHGDSPISVSFLAYYGGDKFLLDTILDVYASLQDQADIAASLAPVTD
SNGIEPSEVMKEKGNAAYKGRQWNKAVSCYTEAIKLNGANATYFCNRAAAYLELGRFQQA
EEDCTEAILIDKKNVKAYLRRGTARESLIRYKESAADFKHALVLEPQNKTAKIAEKRLRK
LMKKIRTIQNKMVDYLRLLRCFSFTASRDWLFRQSFANAGLRSVTTNLSHTNSIASTTSM
HCWIPKSPNRSKPNLLLVHGFGANAMWQYGEHLRSFTGRFNVYVPDLLFFGLSSTSEPNR
TESFQARCLMRLMEAHGVHTMNIVGISYGGFVGYSLAAQFPEKVEKLVLCCAGVCLEEKD
MEDGLFKVPNLEEATEILIPQTPEKLKELIRFSFVKPIRGVPSFFLWDFIDVMCTEFVEE
KRDLIKSILKDRRLSDLPRIRQKTLIIWGEEDQIFPLELGYRLKRYIGENAEMVVIKKAG
HAVNLEKSKEFLKHLKSFLIDSL
Download sequence
Identical sequences M4CYT6
Bra009383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]