SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra009396 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra009396
Domain Number 1 Region: 63-294
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.45e-84
Family Inorganic pyrophosphatase 0.000000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra009396
Sequence length 298
Sequence
MAATRVLTAAAATTQPTSCFLSKRAFLLPAKTSSFALSFNRRALVLKSKRTFSCSAIYNP
QTKVQEEGQSETLDYRVFFLDGGSGKKVSPWHDIPLTLGDGVFNFIVEIPKESKAKMEVA
TDEDYTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPSQANPEVEGAFGDNDPVDVVEI
GEAQRKIGEVLKIKPLAALAMIDEGELDWKIVAISLDDPKAHFVNDVDDVEKHFPGTLTA
IRDWFRDYKIPDGKPANRFGLGDKPANKDYALKIIHETNESWAKLVKRSVDAGDLSLF
Download sequence
Identical sequences M4CYU9
Bra009396 XP_009122531.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]