SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra009476 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra009476
Domain Number 1 Region: 258-374
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-33
Family Synaptotagmin-like (S variant) 0.051
Further Details:      
 
Domain Number 2 Region: 424-543
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-23
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra009476
Sequence length 544
Sequence
MGFFGSVLGILGFAIGIPIGLVVGFFVFVYSQPSHEEYPPARPLVETSITLLLDLLPDIP
LWMKNPDYERVDWFNRFLSYMWPYLDKAICEIIKSSAQPIFADYIGTFCIESIEFETLSL
GSLPPTVHGNAGVKFYETNEKELLFEPSVKWAGNPNIVLVVKLMSLRIKVQLVDLQIFAI
MRVALKPLLPTFPCFGAVVVSLMEKPHVDFGLKVLGGDLMSIPGLYRYVQETIKRQVSSM
YHWPQVLEIPILDASTASVKKPVGLLHVNIIRARNLLKKDLLGTSDPYVKLSLTGEKLPA
KKTTIKKRNLNPEWNEHFKLIVKDPTSQVLQLEVFDWDKVGGHDRLGMQMIPLKKINPGE
KKVFNLDLIKNSNIVMDVPEKKQRGRLELDLRYVPFRDESLKYRNDVQDEKSSEDDDEFL
SNAGLLSVAIQSAKDVEGKKKYTNPYALVLFRGEKKRTKMLRKTRDPRWNEEFQFTLEEP
PLKESIRVEVMSKGTGFHFRSKEELGHVDINLDDVVANGRINQKYHLINSRNGVIHVEIR
WTTG
Download sequence
Identical sequences M4CZ29
Bra009476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]