SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra009816 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra009816
Domain Number 1 Region: 59-75,106-216
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.69e-17
Family Phospholipase D 0.055
Further Details:      
 
Domain Number 2 Region: 330-504
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000000000359
Family Polyphosphate kinase C-terminal domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra009816
Sequence length 509
Sequence
MRRVLLYAFVLVLASLSLPRFVDSSDRCKAWLVQSNPTDMPELPLIPGVLSTGDVFQWLA
NNSTRSLDIIAQYWQLLASPKDPRSGDFGYSDSDLQQFGAHLGSLVYKSIDSAANRNVSI
RLLSHSGVYPEYTKEPSDLANGRPNVKNVTLLLSKWYGSGIVHAKVWISDDRDVYIGSAN
NDWKSLTQVKEVGIYLSGCSQIARKIKTYFDNLWRLASLDSSVHTRNASDQQWLINRTVP
CWSRFIPSKARCKSPLPSYIETPNVSPGYPPLSDPEMFNIDIGTLPRNRSCQETQPSYLS
FAPPELLFGKHQSDEQGWIDTIKSVVEGGTVRINTMDWLGQSQYTNPTVYWSSLSSAVSQ
VVFAKNAKVKILVAYWGHFIPATDGYLRSLLYSNVLCSSSSVQSKCFGQVEIRYYMVPGF
NKTGPAVRNGTKTGNLYPGYTRVNHGKYVVSDVRAHIGTSNLVWDYFYATSGVSFGTYNI
EFVLKLQEIFDADWNSPYVVPVQEFGQDV
Download sequence
Identical sequences M4D018
Bra009816 XP_009151035.1.100322 XP_013643718.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]