SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra009836 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra009836
Domain Number 1 Region: 139-346,379-413
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.98e-30
Family Nuclease 0.082
Further Details:      
 
Domain Number 2 Region: 473-584,630-677
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.4e-28
Family Nuclease 0.088
Further Details:      
 
Domain Number 3 Region: 8-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000003
Family PLC-like (P variant) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra009836
Sequence length 932
Sequence
MAEQLLLHGTLEVKIYRIDKLHQRARFNLRGKGDKEPTTGKKIQTQIKRLAASCTDLLGG
HLYATIDLDRSRVARTMMRRHTKWFQSFHIYAAHSISKIIFTIKEDEPIGANLIGRAYLP
ATEVISGQPVDRWLDVLDQNKRPIQGGVPNAFFNQREGCKVTLYQDAHVLGEYPDITVAG
GQAIYIHHRCWEDIFDAIWDAKHLIYITGWSVYPDITLIRDPKRPRPGGNLKLGELLKKK
AEENVTVLMLVWDDRTSNEAFKRDGLMMTHDQETYDYFKNTKVRCVLCPRNPDNGESIVQ
GFGVAAMFTHHQKTIVVDAEVDGLKTKRRIVSFLGGIDLCDGRYDTEEHPLFGTLNNVHS
NDFHQPNFDGASIKKGGPREPWHDIHCRLDGPAAWDVLYNFEQRWMKQGNGRRYLVSMER
FSEITVPPLPIVQPDDVEGWTVQVFRSIDNGAVEGFPEDPREASSVGLVTGKNNVIERSI
QDAYINAIRRAKHFIYIESQYFLGSSFGWNSRDINLNEINALHLIPKEISLKIVSKIEAG
ERFSVYIVIPLWPEGKPGSASVQAILDWQRRTMEMMYTDIIIALRKKGLDANPRDYLTFF
CLGNREVNKAGEYSPPEKPDANSDYARAQESRRFMIYVHSKMMIVDDEYVIIGSANINQR
SMDGGRDSEIAMGAYQPNHLLATNQLRPRGQVFSFRISLWLEHLRIVTNTFQFPESEECI
RMVNAKADELWGLYSAQVYPRDHDLPGHLLSYPISIGSNGEVTSLAGAEFFPDTNAKYRG
CFGSCNKPPPLIVAVDEPSKGLRIQGRLVKKPSVSDDFWSTSTCDMDNNSTMQSQRSVSS
ISFTNNTATSASSSSNPNEFVNTGLNLWNQTRQQWLASGSSRTKAKVREPTISWNATYES
LLGVNKRFSRPIPLPEMVDFLVDVWEQEGLYD
Download sequence
Identical sequences M4D038
Bra009836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]