SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra010045 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra010045
Domain Number - Region: 157-194,431-466
Classification Level Classification E-value
Superfamily TPR-like 0.00287
Family Tetratricopeptide repeat (TPR) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra010045
Sequence length 605
Sequence
MGKKENEMSAMEIDDPKSDGSEQILPRFSMNVLQLMKTSQAQHGLRHGDYARYRRYCSAR
LRRLYKSLKFTHGRGKYTRRAILESTVTDVRFLHVVFYMTERAWSHAMDKRQLPDGPNAR
QRIYLIGRLRKAVKWASLFSSLCSNKTDSRTSLEAEAYASYMKGTLLFEQDQNWETALAC
FRNARAVYEELGKYGDLENQVLCRERVEELEPSIEYCKHKIGKSNLQTSELLQIGEMEGP
ALDLFKAKIEAAMEEARSQQAASLTEFNWLGYRFPVSNPKSRVSILKAQDFEKELQGPGA
EFLPAEKKLTIYDKLFTAYHDARTIIRSDLVSAGNAESVKDDLNGLDKAVGAVLGQRTIE
RNQLLVKIAKSKLNRKRDDKTEKVTKPEELVRLYDLLLQNVADLSDLISSGRDRKSEEIA
FEEECQRKSLAFRAERCFYLAKSYSLAGKRVEAYALYCRARSLTEDALSKFQSIANKDEG
TIQELKELSKECRANSCIEHATGIMEEEKAPEKLSKKISTISLNDTTTKVEKYLVDKLEE
YESAVGDGNTKMAPKIERFPPGFETIPRNPIVLDLAYNCIEFPVLEERKKTERKGFISRL
WGGRN
Download sequence
Identical sequences M4D0P6
XP_009151314.1.100322 XP_009151315.1.100322 XP_009151316.1.100322 XP_009151317.1.100322 XP_009151318.1.100322 XP_018508078.1.100322 Bra010045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]