SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra010512 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra010512
Domain Number 1 Region: 189-351,377-412
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.34e-28
Family Nuclease 0.089
Further Details:      
 
Domain Number 2 Region: 504-607,648-730
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.63e-26
Family Nuclease 0.052
Further Details:      
 
Domain Number 3 Region: 12-44,72-155
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.55e-22
Family PLC-like (P variant) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra010512
Sequence length 807
Sequence
MAENVSEDVILLHGDLDLKIVQARRLPNRDTFSERMRRCFKPCNSCIKPTTDDYDGEASS
DDENIPGLPRNTSDPYVTVSVPHATLARTHVLKNASDPVWNRHFKVSVAHPLSYLKFKVK
DYDVSGAQTIGTVRIPVQQIASGERIWGWFPVLGGSGKPPKKETALRIDLKFTSFDKIQT
NKTLGGVMGTYFPLRKGSQVRLYQDAHVMDGMLPEIRLDNGDVYQHGKCWEDICHAICEA
HHMIYIVGWSVFHKVKLVREPTRELPRGGDLTLGELLKYKSEEGVRVLLLVWDDKSSRDK
FGISTVVGTLFTHHQKCVLVDTQAVGSNRKVTAFIGGIDLCDGRYDTPEHRIFHDLDTVF
KDDFHNPTFPSGAIAPRQPWHDMHCRLDGPAAYDVLINFEQRWRKATRWKEFNLKGKTLW
LDDSLLRIGRISWILNPKFKYRIDGVLDVPEDDPVVYVSNEDDPENWHVQVFRSIDSGSV
KGFPKCENEAEALHLQYDKRLVVDKSIQTAYIQIIRSAQHFIFIENQYFLGSSYAWPDYN
DAGADNLIPMELALKITSKIRAKERFAVYVVIPMWPEGDPKSGPMQEILYWQSQTMQMMY
DVIARELKSHQSNAHPLDYLNFYCLGKREQLPDDMPATNVSGVTDSYKFQRFMIYVHAKG
MIVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPHHTWANKGKHPRGQVYGYRMSLWAE
HLGKTGDDFVEPGDLKCVKNVNEIAERNWRKFIDSEFSELQGHLIKYPLHVDIDGNVTSL
PGYDSFPDVGGKIIGDHSKAIPDTLTT
Download sequence
Identical sequences M4D212
Bra010512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]