SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra010856 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra010856
Domain Number 1 Region: 295-459
Classification Level Classification E-value
Superfamily TPR-like 0.00000303
Family Tetratricopeptide repeat (TPR) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra010856
Sequence length 512
Sequence
MRIFRLSSVAPRIFQSNHYTTLSPAAAIAGALQEHINSPSPNSGKKIHADIIKTGFRPNL
NISIKLLILHLKCGCMTYARQVFDELPKPTLSAYNYMISGYLKQGLVKQCLLLVQRMAFS
GEKADGYTLSMVLKASSSSSSTSLGSLCRLVHARIIKGHVELDDVLVTALVDAYVKSGKL
ECARTVFETMKDESVVCSTSMISGYMNQGFVEDAEEIFDKTRVKDIVVYNAMVEGLSRTG
ETAKRAVEMYVSMQRAGFHPNISSFASVIGACSVLTAREVGMQVHGQVMKSGVYEHIKMG
SSLLDMYAKCGGIDDARRVFDQMQERNVFSWTSMIDGYGKNGNPEEALELFAKMKEVNIA
PNYVTFLGALSACSHSGLVEKGYEVFESMQRDYSMRPKMEHYACMVDLMGRAGDLSKAFE
FVRAMPERPNSDVWAALLSSCRLHGNVDIASAAASELFKLNADKRPGAYIALSNVLASAG
KWEKVSEIRDVMKARKIPKNIGRSWISADKAQ
Download sequence
Identical sequences M4D303
XP_009109697.1.100322 XP_009109698.1.100322 Bra010856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]