SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra011565 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra011565
Domain Number - Region: 707-873
Classification Level Classification E-value
Superfamily TPR-like 0.00216
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra011565
Sequence length 1150
Sequence
MEVTSSFISTTTSSKYLTLTSYSPVILPASSLRSIRTDFLGCCHTLRPPPHHHHLRTRAG
KRKTSRSSPRLVVRASIDSGLILVVVAVTAFSAIAFAYCQNSFRKRKLSDKVSQVFDKTS
QLSDKVSNLSDKAIQLSDKVAESPETLHGGKISSTESQQESQHLDVHEGNPVEVNGSFRK
KVEEEAHQIQENANETVASSSITRGFSKKVEESANKSEEEEAHQVQEAAVMEYDPFVAKE
MAAEESQFAVAGVSTIASEHSSIDESLSSSLSNGHVAVESATLGTQAPEEQMVMENGFSQ
AVMGVHSVASPHVVVDDDTHALENKYNGLAQKPVDYSIFTESKREEIHTFYGSNHSSPTS
SRLTSVKAVSPTLTSPATDSLLLDHKNGGVIDTQFSGPSSNQATGYVEEENLVGHGNGGL
SYKRKDVRRDWEVPDDGKKHVVHQTDESMPEFPSQILNSNGRSPKTSDAYHQLVRDGRLM
ECINLLEDLDQRDLLDMDKVYHASFFKLCKKKRTVKEAFRFTKLIPNPTMSTFNMLMSVC
ASSQDIEGARGVLQLVQENGMMADCKLYTTLISSCAKSGKVDAMFEVFHQMANSGVEPNL
HTFGALIDGCARAGQVAKAFGAYGILRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAE
MKAETHPIDPDHITVGALMKACFNAGQVERAKEVYTMIHQYGIKGTPEVYTIAVNSCSKS
GDWDFACSIYNDMKEKGVIPDEVFFSALIDVAGHAKMLDEAFGILQDAKSQGIRLGTITY
SSLMGACCNAKNWKKALELYEKIKSIKLRPTVSTMNALITALCEGGQLPKAMEYLDEIKT
LGLTPNTITYSMLMLASERKDDFEVSFKLLSRAKEDGVSPNFIMCRCITSLCKRRFEKSC
AAGEPVVSFKSGRPQIENKWTSMALMVYRETISGGTVPTTEVVSQVLGCLQLPHDADLRD
RLVSNLGNVSSQKQHNIFPLVDGFGEYDPRAFSLLEEATSLGVLPSMSFNKVPLFFDTTE
LPKNVAEVYLLTIFKGLKHRLAAGAKIPHINLIISIEEKEITTPEGEKTIDLAGRVGQDI
SALLRRLGIPYHRKDAKLRINGVALKNWFQPKLDSPFSTKPGDLRSSQVPLGNQITRQQR
SIRLGNLSLE
Download sequence
Identical sequences M4D508
XP_009108450.1.100322 Bra011565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]