SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra011588 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra011588
Domain Number - Region: 385-408,474-507,601-647
Classification Level Classification E-value
Superfamily TPR-like 0.000538
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Domain Number - Region: 341-490
Classification Level Classification E-value
Superfamily TPR-like 0.00325
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra011588
Sequence length 803
Sequence
MSALARCSPIYYNCDACKCVSSSQNHQTNENRNLVTNRRFSKPNRLILHNRSKKLNDPSL
TRALRDFADSGLMEDALHLFDEMNKVDTFLWNVMIKGFTACGLHHEALRFYRRMVFTGIK
ADSFTFPFVIKSAAGASSLSQGKTVHAAVIKLGFDSDVYVCNSLISFYMKLGCERDAENV
FDEMPERDIVSWNSMVSGFLAVGDGLRSLVMFKEIMRFGFEPDRFSIMSALGACSHVEDC
LRMGKEIHCYAIRSGIEDVMVLTSVLDMYSRYSEVSYAERVFNGMSNRNIVAWNVMIGCY
ARNGRGVDAFLCFQKMSERTDVITLINLLPACEEILEGRAVHGYATRRGFLPHVVLETAL
IDMYGEGGKVKSAEAVFDRMGEKNLVSWNSMIAAYVRNGENYSALKLFQELWDWDWDSSS
LVPDSTTIASILPAYAESLSLSEGRQLHAYVVKARYSSNTIVLNSLVHMYAMCGDLGDAR
KCFDQVVFKDVVSWNSIIMAYAVHGFGRISVCLFSEMVTTSGVSPNKSTFASLLAACSIS
GMIDEGWDYFNSMKREYGIDPGIEHYVYMVDLIGRTGNLSSAKRFIEDMPFVPTARVWGS
LLKASRNHNDITVAEFAAEQVLKMEHDNTGCYVLLLNMYSEAGRWEDVDRIKLLMKSQGV
SKTTSCSTVVTRGRTHVFTNGDRSHVETNKIYEVLDIVSRMVEEEEEEEESYVHCVSKMR
PETLLKKKRNSPRRHSVRLATCLGLISTETGRAVVVRNNTRICRRCHEFLEKASKVTRRE
IVVGDSKIFHHFSNGCCSCGNYW
Download sequence
Identical sequences M4D531
Bra011588 XP_009105444.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]