SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra011638 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra011638
Domain Number 1 Region: 1-1440
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 0
Family RNA-polymerase beta-prime 5.77e-19
Further Details:      
 
Domain Number 2 Region: 2056-2250,2277-2314
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.44e-27
Family Phospholipase D 0.059
Further Details:      
 
Domain Number 3 Region: 2406-2509,2550-2639
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 9.68e-26
Family Nuclease 0.052
Further Details:      
 
Domain Number 4 Region: 1868-1901,1931-2033
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.29e-23
Family PLC-like (P variant) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra011638
Sequence length 2709
Sequence
MSVMHVDHSETTEKGKPKVGGLSDARLGTIDRKVKCETCMANMAECPGHFGHLELAKPMY
HVGFMKTVLSIMRCVCFNCSKILAHEEEHKFKQAMKIKNPKNRLKKILDACKNKTKCADD
DNLEDVQDQDMDESGKKIRGGCGAVQPKLSIEGMKMVAEYKNTRKKNDEKDQLPEPAAMK
QTLGADRVLSVLKRISDEDCQLLGFNPKYARPDWMILEVLPIPPPPVRPSVMMDATSRSE
DDLTHQLAMIIRHNENLKRQEKNGAPAHIISEFTQLLQFHIATYFDNELPGQPRATQKSG
RPIKSICSRLKAKEGRIRGNLMGKRVDFSARTVITPDPTINIDELGVPWSIALNLTYPET
VTPYNIERLKELVDNGPHPPPGKTGAKYIIRDDGQRLDLRYLKKSSDHHLELGYKVERHL
IDGDSVLFNRQPSLHKMSIMGHRIRIMPYSTFRLNLSVTSPYNADFDGDEMNMHVPQSFE
TRAEVLELMMVPKCIVSPQANRPVMGIVQDTLLGCRKITKRDTFIEKDVFMNTLMWWEDF
DGKVPAPAILKPRPLWTGKQVFNLIIPKQINLFRYSAWHSDQETGYITPGDTQVRIERGE
LLAGTLCKKTLGTGNGSLVHVIWEEVGPDAARKFLGHTQWLVNYWLLQNGFTIGIGDTIA
DSSTMAKINETISSAKTAVKDLIRQFQEKKLDPEPGRTMTETFENRVNQVLNKARDDAGS
SAQKSLAETNNLKAMVTAGSKGSFINISQMTACVGQQNVEGKRIPFGFEGRTLPHFTKDD
YGPESRGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTSETGYIQRRLVKAMEDIMVK
YDGTVRNSLGDVIQFLYGEDGMDAVWIESQKLDSLKMKKSEFDRTFKYEIDDVNWNPTYL
SDEHLEDLKGIRELRDVFDAEYQKLEADRYQLGTEIATNGDSTWPLPVNIKRHIWNAQKT
FKIDLRKISDMHPVEIVDAVDKLQERLLVVPGGDAMSVEAQKNATLFFNILLRSTLASKR
VLEEYKLSREAFEWVIGEIESRFVQSLVAPGEMIGCVAAQSIGEPATQMTLNTFHYAGVS
AKNVTLGVPRLREIINVAKRIKTPSLSVYLTPEASRSKEGAKTVQCALEYTTLRSVTQAT
EVWYDPDPMSTIIEEDYEFVRSYYEMPDEDVSPEKISPWLLRIELNREMMVDKKLSMADI
AEKINLVFDDDLTCIFNDDNAEKLILRIRIMNDEGGKGEGQDESAEDDVFLKKIESNMLT
EMALRGIPDINKVFIKQVRKSKFDEEEGFKTSEEWMLDTEGVNLLAVMCHEDVDPKRTTS
NHLIEIMEVLGIEAVRRALLDELRVVISFDGSYVNYRHLAILCDTMTYRGHLMAITRHGI
NRNDTGPLMRCSFEETVDILLDAAAYAETDCLRGVTENIMLGQLAPIGTGDCELYLNDEM
LKNAIELQLPSYMDGLEFVGMTPGRSPFSGTPYHESIMMTPNYLSTPNVSDAQFSPYVSG
MAFSPSSSPGYSPASPGQSPASPGYSPTSPYYSPTSPTYSPTSPIYRPTYSPTSPTYNPT
SYSPTSPTYSPTSPYYSPTSPTYSPTSPYYSPTSPTYSPASPYYSPSSPGSSPTSPSYSP
TSPSYYSRTSRSYSPTSPAYKAYSPTSPAYSPTSPSYIATSPSYSPTSPSYGPTPYSPAS
PGYSPTSPSYSPTSPSYGPTSPSYNPQSAKYSPYLAYSPSDARLSPASPGYSPTSPNYSP
TSPSYSPTSPSYSPSSPTHCPSSPYSSGASPDYSPNAGYSPTLPGYSSSSTGQYTPHEGY
ENDKTGKDASKDAGHVEKKEERAFQKHLHSGYLCDTVFLQQQQTEPLFVRALGLLLAMAE
KVSDDVMLLHGDLDLKIVQARRLPNMDLFSDRMRRCFTACNSCAKPPEDDEDPRNRDGGD
RNIRGHRKVITSDPYVTVVVPQATLARTRVLKNSQDPLWDEHFNISVAHPMPHLEFQVKD
DDVFGAQIIGTAKIPVHQIASGQRISGWFPVLGASGKPPKKETALYVDMKFTPFHQIEAY
RNGIAGDPDRRGVKRTYFPVRKGSKVRLYQDAHVMDGTLPEVGLDNGKVYKHGKCWEDIC
YAVSEAHHMIYIVGWSVFHKVRLVREPTRKLPRGGDLTLGELLKYKSEEGVRVLLLVWDD
KTSHDKFGISTPGVMGTHDEETRKFFKHSSVICVLSPRYASKLGLVVGTLFTHHQKCVLV
DTQAVGNNRKITAFIGGIDLCDGRYDTPDHRILHDLDTVFKDDFHNPTFPAATKAPRQPW
HDLHCRLDGPAAYDVLINFEQRWRKATRWKEFSLRLKGKTHWQDDALIRIGRISWILSPV
FKFLKDGTSIVPEDDPVVYVSKEDDPENWHAQVFRSIDSGSVKGFPKYEDEAEAQNLECA
KRLVVDKSIQTAYIQTIRSAQHFIYIENQYFLGSSYAWLNYKDAGADNLIPMELALKIVS
KIRAKERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIVRELKAVQSDAHPLD
YLNFYCLGKREQLPENMPATNGSAVSDSYKFQRFMIYVHAKGMIVDDEYVLMGSANINQR
SMAGTKDTEIAMGAYQPHHTWTNKGRHPRGQVYGYRMSLWAEHLGKTGDEFVEPSDLECV
KNVNEIAEGNWKKFTNIEFSELQGHLIKYPLQVDSDGKVSSLPDYDSFPDVGGKIIGAHS
MALPDTLTT
Download sequence
Identical sequences M4D581
Bra011638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]