SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra012823 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra012823
Domain Number 1 Region: 162-314
Classification Level Classification E-value
Superfamily TPR-like 5.48e-25
Family Tetratricopeptide repeat (TPR) 0.0013
Further Details:      
 
Domain Number 2 Region: 45-154
Classification Level Classification E-value
Superfamily FKBP-like 6.09e-19
Family FKBP immunophilin/proline isomerase 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra012823
Sequence length 357
Sequence
MDESPLEQQSQSHEQENEIVTEGSAFGHGEPPSQDGSVPPKVDSPVEVLDEKVSKQIIKE
GHGSKPSKYSTCFLHYRAWTKHTQHKFEDTWQEQQPIELVLGKEKKEMTGLAMGVASMKS
GERALLHIGWELGYGKDGNFSFPNVPPMADLLYEGKARSDMTVEERIGAADRRKMDGNNL
FKDDKLEEAMQQYEMAIAYMGDDFMFQLYGKYQDMALAVKNPCHLNMAACLIKLKRYDEA
IGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSAREDFRKAQKYAPDDNAIRRELRGIAE
QEKAVYQKQKEMYKGIFGGGRDESGGKGKSRNWLIMLWQWLVSLFSRILGRNRVKAD
Download sequence
Identical sequences M4D8L3
Bra012823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]