SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra012838 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra012838
Domain Number 1 Region: 668-871
Classification Level Classification E-value
Superfamily TPR-like 5.15e-17
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 2 Region: 412-456,490-577,616-660
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000356
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number 3 Region: 209-307
Classification Level Classification E-value
Superfamily POZ domain 0.0000000275
Family BTB/POZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  Bra012838
Domain Number - Region: 304-364
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0184
Family BCR-homology GTPase activation domain (BH-domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra012838
Sequence length 922
Sequence
MRSLKLAEGCKGTQVYALNPPPGGGVGDKLLQHLQDHLRVNSIRSKSSRTYHQSSLLLPY
GLPVTDLLEPQIDPSLKFPDLVEKMAEVYRRVAASTNLERSGAFLEQCAVFRGLSDPKLF
RRSLRSSRQHAVDVHAKVVLSSWLRFERREDELIGTCSMDCCGRNLECPKASLVPGYDPV
TVYDPCRCSGSNGVAECSTSDEAFAFAFEYDMSFCIGDEEVRCVRYKIASLSRPFEAMLY
GGFRETKLGTISFTQNGVSVEGMRAAEVFSRTKRLDEFPPNVVLELLKLANRFCCDELKS
CCDTHLARLVSTLDEAMVLIEYGLEESAYLLVAACLQVFLRELPSSMHNPNVIKIFCSVE
GRERLASLGHASFALYFFLSQIAMEDDKKSNKTVMILWRLVECALESWEKQLAYHQLGVV
MLERKEYKDAQRAFNTAVEAGHLYSLVGVARSKFKRDHRYSAYKIINSLISDHKAATGWM
HQERSLYCSGKEKLIDLDTATELAPTLTFPYKFRAVAWVEENQFNAAISELNKVLGFKAS
PDCLEMRAWVSIGKEDYEGALKDIRALLTLEPNFMMFNGKIHGDHMVELLRPLAHQRSQA
DCWMQLFDHWSSVDDIGSLAVVHDMLAHDPGNSLLRFRQSLLLLRLNCQKAAMRSLRLAR
NHSKLKHERLVYEGWILYDTGHREEALAKAEESISIQRSFEVFFLKAYALADSTLDPKSS
EYVIQLLEEALRCPSDALRKGQALNNLGSVYVDCDKLDLAADCYTNALNIKHTRAHQGLA
RVYHLKNQRKAAYDEMTKLIEKAQNNASAYEKRSEYCDREMAQSDLSLATELDPLRTYPY
RYRAAVLMDDHKENEAIEELSKAISFKPDLQLLHLRAAFYDSMGEGASAIKDCEAALCID
PSHADTLDLYHKARETNATDQK
Download sequence
Identical sequences M4D8M8
Bra012838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]