SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra012946 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra012946
Domain Number 1 Region: 133-292,339-367
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra012946
Sequence length 376
Sequence
MPSLISQQWQERTSGFFSSSGTKLREARQSAGAFVGEVAKDAKVNVSDVAERVGSLFKSR
WAILQQPATRHAVQEHLITAAATTGTLVRKGITETKEKVSVGKIKVEEAAKKTAQKSKTL
LTDIERWQKGVASSDVFGVAIEVTVQRQESTRPIPIIMIKCADYLILTGLNSPNLFKTEG
DKKLIQQLVSAYNQDPSASIPEGVNPVDVAALMKYYLASLPTPLTTFELYNEIKDARSSV
NRMRKSLQKLSSVNYNTLEFVTALLLRVSEKSQLNKMDSHSLAMEMAPVIMWREDKRPES
YREYWRRPSRSPKKSNDFETATPWDLLSDEGEGVDASSSISLDDIVQVDFGAVEVVQCLI
EHHNAIFTDADETVWR
Download sequence
Identical sequences M4D8Y6
Bra012946 XP_009136486.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]