SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra013462 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra013462
Domain Number 1 Region: 5-250
Classification Level Classification E-value
Superfamily TPR-like 5.06e-39
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra013462
Sequence length 291
Sequence
MSSDPEKMMSKADKMTKLTLTRWSADWRGATELYEQAANGFRASSKYERAKVALEKASQG
QVMQSSPWDAAKHMESAAALAQKLSIWDEVADFYRKASELYVECGRAQPASDALGKAARA
LEEVKPEDAIQLYTDACEILEEDGRDQMAFDLYRACASVYIKLEKFTDAATFFLRLGVAA
DKCDATNSQCKAYLSAIIVYLYGHDLKQAEKCYNDCSQIDAFLKSDQNRTASRLLTAYNE
GDIEEIKKVACSSTVSNLDHAIIKLARKLPTGDVTAVQMNAGDDLDEDDLT
Download sequence
Identical sequences M4DAF2
Bra013462 XP_009133787.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]