SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra013499 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra013499
Domain Number 1 Region: 1284-1387
Classification Level Classification E-value
Superfamily BRCT domain 4.36e-22
Family BRCT domain 0.0019
Further Details:      
 
Domain Number 2 Region: 1395-1490
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000048
Family BRCT domain 0.023
Further Details:      
 
Domain Number 3 Region: 582-640
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000177
Family RING finger domain, C3HC4 0.0098
Further Details:      
 
Weak hits

Sequence:  Bra013499
Domain Number - Region: 248-441
Classification Level Classification E-value
Superfamily TPR-like 0.00175
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra013499
Sequence length 1492
Sequence
MLDKCITLLQSYGLSSLKKLKQVYAFSIRHGVSITDPEMGKHLIFYLVSLPSPPPMSYAH
KIFSEIEKPFNVFIWNTLIRGYAETCDSVSALSLFREMRVSGLVEPDTHTYPFLLKAVAK
MADVRLGETIHSVVIRSGFGSLIFAQNSLLHLYGNCGDVVSAYKVFDEMPVKDLVAWNSV
INGFAENGKPNEALGLYSEMMGSKGIKPDGFTIVGLLSACAKIGALALGKRVHVFMIKVG
LTGNLHSCNVLLDFYARCGRVEEAKTLFSEMVEKNSVSWTSLIVGLAVNGFGKEAIELFK
DMESKEGLLPCEITFVGILYACSHCGMVDEGFEYFRRMREVYKIEPRIEHFGCMVDLLAR
AGEVKKAYEYIKAMPMHPNVVIWRTLLGACTVHGDSDLAELARIKILQLEPNHSGDYVLL
SNMYASEQRWSDVQKIRSKMLEDGVRKVPGHSLVEVGNRVHEFLMGDKSHPQSEQIYAKL
KEMSDRLRVEGYVPQISSVYVDVEEEEKENALVYHSEKIAIAFMLISTPERSPIRVVKNL
RVCADCHLAIKLVSKVYEREIVVRDRSRFHHFKDGSCSCQDYCLSLFDSAASLSCNHVFC
NECIVKSMKVDATCPVCKIPFHRREIRGAPHMDSLVSIYKNMEDASGVHMFVSQNIPSPS
EKEKHVGDASIERKNGKRHQGASKGRVSKIRGCKKAKERDLDAPGPIVMKPSSQTKKRVQ
LLQNQSTTESLTKSTESFEPAEKLKDYTEETVIRLNEHTSLNKVENMAPFFWLRDEDDEE
SLSQPAESDPFLDVTPVDVPSFSDLKDSDHDSPSKAIEQERPNPGEMFDSEMFEWTQRPS
SPEILPSPVKAKALRKDETQMNLPKGASSNKKRKAGTARKTVAKRLVGVSKEDYTEPSAG
ATISEKQESGGNSGTSTRKDENVKAKRATRNKGQISLVEEAGVNTHVEAEVKQGTKRKRS
SVKVSPNPPVAGSNELSLGTEDVGKGYQELTHGSAGTQPEKQSPSEKYSLRKRIKSSAPS
LPKCSPVITKKKTSEKRSKLGSSSIPSRVTQIIRDELNQLGDRQDSSNKKKPSVDEGTHT
MQVSEKSSTMNKPSLGDNALLRRCDGPLTSKFTCAFCQSSEDTEASGEMAHYHRGEPVSA
DFSGGSKVIHAHKNCAEWAPNVYFNNLTAVNLDAELTRSRRITCSSCGLKGAALGCYNAS
CKSSFHVTCAKQIPECRWDNKNFVMLCPSDASSKLPCEETSPKGRKRKCSPPKGLQHSRP
NQVSVIPDISENQSKPFHGLSKKLVLCCSGLTDEEKSVISEFAELSGVTILRKWEPRVTH
IIASINDNGACKRTLKFMMGVLEGKWILSIDWIKACMNNREYVTEEPYEISIDVHGTRQG
PYIGRQRALNKEPKLFSGLKFYMMGDFEVAYKGYLQDMIVAAGGTILLRRPIADDDSEAS
TIIVFSVEPSKKKTLTQRRSDAEALAKSSRARAASSSWVLDSIAGCQILDLI
Download sequence
Identical sequences M4DAI9
Bra013499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]