SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra013508 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra013508
Domain Number 1 Region: 235-326,363-391
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.48e-25
Family Synaptotagmin-like (S variant) 0.025
Further Details:      
 
Domain Number 2 Region: 78-148
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.18e-16
Family Synaptotagmin-like (S variant) 0.034
Further Details:      
 
Domain Number 3 Region: 142-209
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.000000000212
Family Pyk2-associated protein beta ARF-GAP domain 0.0053
Further Details:      
 
Domain Number 4 Region: 15-43
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.000000863
Family Pyk2-associated protein beta ARF-GAP domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra013508
Sequence length 393
Sequence
MSYSAAGQGNNSSGKRRISDLLTQSDNRVCADCSAPDPKWASKYEHQEFLKPSLRITSVK
GSNSSSSQQPHLEGMVEFIGLLKVTLKKGTNLAVRDTRTSDSYVVLTLGQQTAKSTVMKS
NLNPVWNEELMLSVPHDYGSVKLVLSVTLDEWSDDEVDSMIEIGGNASANSIYEAFIPDG
VSKPGPDASHDQRMRFIRSKYEHQEYLKPSLRITSVKGPNSSSSQQPHLEGMAEFIGSLK
VTLKKGTNLAVRDMRTSDAYVVLTLGQQSAQSTVMKSNLNPVWNEELMLSVPHDYGSVKL
QVFDYDTFSADDIMGEAGIDIQPLITSVMAFGDPEMFGDMQIGKWLKSCDNALIEDSIIN
IVDGKVKQEVHIKLQNVESGELELELEWLPLDQ
Download sequence
Identical sequences M4DAJ8
Bra013508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]