SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra013816 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra013816
Domain Number 1 Region: 233-425
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-32
Family BCR-homology GTPase activation domain (BH-domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 18-177
Classification Level Classification E-value
Superfamily PH domain-like 1.58e-18
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra013816
Sequence length 937
Sequence
MAPTKNAESSSSSSSSQPPPQVQPPQQQQQNQQQQNSNPHEQQDLETHGDTCSIPQSGNG
NADSRSRGGNTVFKSGPLYISSKGLGWTSWKKRWFILTRTSLVFFRSDPSAVQQRGSEVN
LTLGGIDLNNSGSVVVKADKKLLTVLFPDGRDGRAFTLKADTMEDLNEWKAALENALTQA
PNASHVMGQNGIFTNDHADAPVSVEEQKDETPTRSTVIGKPVLLALEDVDGSPSFLEKAL
RFVEDHGVNTEGILRRAADVDDVEHRIREYEQGRNEFTPTEDAHVIADCLKYVLRELPSS
PVPASCCNALLEACRSDRGNRVNAMREAICESFPEPNRRLLQRILIMMQVVASNKNVNRM
NTNAVAACMAPLLLRPLLAGDCEIENDFDVGGDGSMQLLQAAAAANHAQAIVITLLEEYA
SIFGEGSLSPGLYSDSGESGSGTEVGTDDEEYDDDDDEYDGTQGSADYTDEEEDLENESN
GSYSENAALDDNHGNDIDHDDHKARSYTKVNDNLSSESKTPKGTTEPLVTKKLLSSSKRS
SLPRHDDAKRDENRLVKGADNAEVKGVAEVATTEDKISSIPDVASDIKKPSTLSSPPGGS
NKRWGRTPGKKNLSMESIDFSAEVEVDEDDADIERLESAKSELQNSISEEVKNNAVLQAS
LERRKKALYVRREALEKDVERLQEQLQLERDKKSALEAGLKMSKVNQPIPEIADEKLKKD
LHDVAQAETDIANLEHKVDDLKKKLSHQDAKASGSTHGASKEPRSIPENSAKMKEKQKDT
EAASTHVSERSSSLKDEQGSARENETEKQQDQRSKSSQQETSRGSSKSAGMSKRSGSKGD
RDGVRSQASSQTWTKEKAQGNPVHPRCKTKVYSKRKEKQDQTKARTRSHRAASSTASMFL
TEEDLRTEETEAEEDLEETNPAQHQGPSPDNLFIRAA
Download sequence
Identical sequences M4DBF6
Bra013816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]