SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra013937 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra013937
Domain Number 1 Region: 171-250
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000031
Family Calmodulin-like 0.031
Further Details:      
 
Domain Number 2 Region: 68-165
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000835
Family Synaptotagmin-like (S variant) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra013937
Sequence length 636
Sequence
MGNGNSTETKESRRSKMRQKLQTFSSRRRLRRPGSGSVSGLATQRSVSQEDFAGIALLTL
IGAEMKFKDKWLACVSFGEQTFRTGISDSTDKPVWSSEKKLLLEKNGPSLARISVFETNR
LSKNNIIGYCELDLLEFVVQEPDSTCKSFDLLDPTSSNVVGSMFISCSVEDPVETETCFA
KRILSIVDYNEDGHLSFSEFSDLMNAFGNLVASKKKEELFKAADLNGDGVVTIDELAALL
AVQQEKEPIINNCPVCGEALQLSDKLNAMIHMTLCFDEGTGNQMTGGFLTDRQASYGWMF
KLSEWTHLSTYDVGLNTGSSASHIVVIDRKTKRLVEELIDSKIVMSMRAIYQSKIGLGLM
DQGAKEILQNLSEKQGKKMNTAESAQNIPSFLEFFKDQINMAEVKYPLDHFKTFNEFFIR
ELKPGARPIACTDREDVAVSAADCRLMAFQSVDDSTRFWIKGRKFSIKGLLGKDVDSDAF
LDGSLVIFRLAPQDYHRFHSPVSGVIEKFVDVPGSLYTVNPIAVNSKYCNVFTENKRTVV
MISTAEFGKVAFVAIGATMVGSITFVRKEGDHIKKGDELGYFSFGGSTVICVFEKDSIKI
DEDLLANSARSLETLVTVGMQLGVSFPKLENCSLES
Download sequence
Identical sequences M4DBS7
Bra013937 XP_009139758.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]