SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra014445 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra014445
Domain Number 1 Region: 733-867
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.93e-30
Family PLC-like (P variant) 0.043
Further Details:      
 
Domain Number 2 Region: 1042-1181
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.98e-24
Family PLC-like (P variant) 0.015
Further Details:      
 
Domain Number 3 Region: 887-1030
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.06e-22
Family Synaptotagmin-like (S variant) 0.058
Further Details:      
 
Domain Number 4 Region: 454-578
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.36e-16
Family PLC-like (P variant) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra014445
Sequence length 1449
Sequence
MMATSIVASTKKTIKIPLNCKDTTQTCPLNYPSRFKPAISSSETCPDYFRWIHQDLKVWQ
ETGITRETLERAKPNAHFRLVIKSGRLYLHQYDKCYQTRDVFTIWGILQLLKMYPGQVPD
LELLFLCHDQPGIWKKDFTQEGPNATWPPPPLFHYCSHRDAYDIVFPDWSFWGWPEVNVK
EWTTLQVAIREANERVRWKDRVQYAHWKGNSYVSQERRDLMQCNFSDKYDPMVHLYEQDW
EKERENGFKSSNLEDQCTHRYKIYIEGRAWSVSKKYILACDSMALLVKPEFFDFFGRSMV
PMEHYWPIRHQESCRDLKFAVEWGNNNTEKAQEIGRRGSEYMMKRLEMKYVYDYMLYVLQ
GYGKLMRLDVTVPDNATEVCSETMACPITDGGLIRQCMDDSLVTYPSVKAACDLPQPYGD
DELKRFLKNQESAERHVEKLTNDYWEVISARLGDGVNSFVELRFDDQKVKTTTKLDDSSP
VWNERFSFNISDTEDLSNLVLEAYVYNKTSNVTTSCLGKIRILGTAFVPYSEAVGLHYPL
EKEKWSVFSFGSTVRGELTLKVFITDNPSVKIPTPNPRKKLASNTSHSLHNIPASEKTKP
RLRKTQEPPQPQTLSPQPPQPQTLFSQPQTLSRQQQMLSPQPPQLQTLSPQQQMLSPQPL
QPHTLSTQQQMLSPQPSKPQTLSPQPQTLFPQQPPVMEAAPFQPVKYGSPALGGGVRART
TITAHDLVEPMEYLFVKIVKARNLPTMDPTGSLDPYVEVKLGNFTATTTQFEKNKNPVWN
EVFAFTKSDQQANFVDVIVMDKAVMKDKFVGSIRFDLNEIPTRVATDSPIAPQWYIVNHE
RGGEVMLSVWFGTQADEAFSDATYSDALNAVNKSSVYSKVYHSPRLWYLRVNVIEAQDLV
IKPDRTRFPPNPYVNIKLGSQMVRTKPGQSLNPKWNEEFTFVAAEPFEDLEISIQDREET
LGTAKIRFDEIETRVDDNRIVPNRWFSLALERQTRVRFATTRILLNVCLEGGYHVLNEST
YNSSDFRPSMKEVRNRHEQSVGVLELGILGAEGLSLSRDGKKETVDAYCVAKYGTKWVRT
RTVMNSLNPRFNEQYTWEVYEPATVITIGVFDNNGTNGGNIKDGKIGKVRVRISTLESGR
LYTNSHPLLVLRPSGVKNMGELHLAIRFTCTSMFQMLLHYWKPLLPKMHYVRPLKVVQQE
ILREHAVNLVAARLSRAEPPLRKEVIEYITDSNSHFWSIRKSRANLYRLRSVFSGLLGTG
EWFQDICTWKKPVASTAVHVLYLAFVCLPEMILPIISLWLFMLGVWNYRLRPRQPQHMDT
SLSFADNVHPEELTEEFDTFPFSSQDPGVVKMRYERLRSIAGRAQTLVGDIAGQGERVQA
LLSWRDPRATSIFMVVCLVSSVVLYVVPFKVFVLLAGLYIMRHPRLRRKTPPGLVNFFKR
LPAKTDCML
Download sequence
Identical sequences M4DD77
Bra014445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]