SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra015116 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra015116
Domain Number 1 Region: 711-821
Classification Level Classification E-value
Superfamily TPR-like 8.86e-19
Family Tetratricopeptide repeat (TPR) 0.00047
Further Details:      
 
Domain Number 2 Region: 467-558
Classification Level Classification E-value
Superfamily FKBP-like 0.00000000904
Family FKBP immunophilin/proline isomerase 0.0022
Further Details:      
 
Domain Number 3 Region: 623-710
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000112
Family FKBP immunophilin/proline isomerase 0.0034
Further Details:      
 
Weak hits

Sequence:  Bra015116
Domain Number - Region: 548-642
Classification Level Classification E-value
Superfamily FKBP-like 0.000491
Family FKBP immunophilin/proline isomerase 0.0037
Further Details:      
 
Domain Number - Region: 218-361
Classification Level Classification E-value
Superfamily TPR-like 0.0136
Family Tetratricopeptide repeat (TPR) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra015116
Sequence length 829
Sequence
MSAALRRIILLSSVKRAWNLPPPCLSSAVSRLPISFSSVSSPPQSNPPPSRIRTRTPLET
QFETWIQNLKPGFTHPDVVAALRAQSDPDLAYDIFRWTAQQRGYKHNHEAYHSMIKQAIA
GKRNKFAETLIDEVVAGACEMSVPLYNTIIRFCCGRKFLFNRAFDVYNKMLRSDNDSRPD
LETFTLLLSSLLKRFNKLNVCYVYLHAVRSLTKQMKSSGVIPDTFVLNMIIKAYAKCLEV
DEALRVFREMPLYGSEPNAYTYGYLTKGLCEKGRVEQGLGFYKEMRSKGMVPSGSCYMVL
ICSLAMERRLDEAVEVVFDMLANSLSPDMLTYNTALAELCREGRGNEALELLEEWKKRDP
VMGERNYRTLMDEYSLHFINATVLKKIFRKKTTMSHASSMKAAGVLVLFFSYAKKKTADV
TEQQTGVSQVHQGPKEMPQVGGMNDDDDMDLGEDASFLKVGEEKRIQQGLKKKLVKEGEG
FETPDKFKAMKLKVIEGWDIGIKTMKKGENTLDLFYCPFGAGVWGIWLSANATLQFDVEL
LSWSSVKDICKDGGVFKKIREKRETPKDLDEVLVKYEDGTVVGKSDGAEFHCYFCPALAK
AVKTMKKAEIWFSGEGQASLWWVKVAVPPNATLEITLELVSWKIVSEVTDDNKVIKKILK
EGEVKLIGKLQDGTVFPKKGHGEGEEPFEFKTNEEQVIDGLDRAVMKMKKQAKALKVACN
LNDAACKPKLQDYRQAEKLCTKVKLFGLLELESTNVKALYRRARAYMELADFDLAEFDVK
KALEIDPNNREVKVEQRRLKEKMKEFNKKEAKFYGNMFAKVNVSISSFR
Download sequence
Identical sequences M4DF44
Bra015116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]