SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra015788 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra015788
Domain Number 1 Region: 15-116
Classification Level Classification E-value
Superfamily Cupredoxins 3.3e-27
Family Plastocyanin/azurin-like 0.0000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra015788
Sequence length 116
Sequence
MAVAAAASIALAGNAMAIEILLGSDDGGLVFVPSDFTVAKGEKIVFKNNAGYPHNVVFDE
DEIPSGVDASKISMDEQALLNGAGETYEVTLTEPGSYSFYCVPHQGAGMVGKLTVN
Download sequence
Identical sequences M4DH11
Bra015788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]