SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra015889 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra015889
Domain Number - Region: 473-634
Classification Level Classification E-value
Superfamily TPR-like 0.0102
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Domain Number - Region: 179-202,288-417
Classification Level Classification E-value
Superfamily TPR-like 0.0146
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra015889
Sequence length 864
Sequence
MNLAIPNPNSHHLSFLIQNSTFITNRRLFANNPNRLTFLSGGKRPSSVAKINAKTKDLVL
GNPSVSVEKGKYTYDVESLINKLSSLPPRGSIARCLDIFKNKLSLNDFALVFKEFAGRGD
WQRSLRLFKYMQRQIWCKPNEHIYTIMISLLGREGLLDKCLEVFDEMPSQGVARSVFSYT
ALINAYGRNGRYETSLELLERMKSEKISPSILTYNTVINACARGGLDWEGLLGLFAEMRH
EGIQPDIVTYNTLLSACAIRGLGDESEMVFRTMNDGGIVPDLTTYSHLVETFGKLGRLEK
VCDLLNEMASGGSLPDITSYNVLLEAYAKSGSIKEAMGVFHQMQAAGCTPNANTYSVLLN
LFGQSGRYDDVRQLFLEMKSSNTDPDAATYNILIDVFGEGGYFKEVVTLFHDMVEENIEP
DMETYEGIIFACGKGGLHEDARKILQYMTAKDVVPSSKAYTGVIEAFGQAALYEEALVAF
NTMHEVGSNPSIETFHSLLYSFARGGLFKESEVILSRLVDSGIPRNRDTFNATIEAYKQG
GKFEEAVKTYVDMEKSRCDPDERTLEAVLSVYSCARLVDECREQFEEMKASDILPSIMCY
CMMLSVYGKTERWDDANELLEEMLSNRVSNIHQVIGQMIKGDYDDDSNWQIVEYVLDKLN
SEGCGLGIRFYNALLDALWWLGQKERAARVLNEATKRGIFPELFRRNKLVWSVDVHRMSE
GGMYTALSVWLNDLSDMLVKGQDIPQLAVVVSVRGQLEKSSAARESPITKAAFSFLQDHV
SSSFSFTGWNGGRIMCQRSQLKQLLSTQEPTSEESQKSSLVALTNSPIFSAGTRTSTSSD
TNNSSGNPSQRRTRMKKELAGSPA
Download sequence
Identical sequences M4DHB2
XP_009106140.1.100322 Bra015889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]