SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra015895 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra015895
Domain Number 1 Region: 636-716
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000811
Family Smr domain 0.0081
Further Details:      
 
Weak hits

Sequence:  Bra015895
Domain Number - Region: 210-349,454-501
Classification Level Classification E-value
Superfamily TPR-like 0.000311
Family Tetratricopeptide repeat (TPR) 0.052
Further Details:      
 
Domain Number - Region: 391-436
Classification Level Classification E-value
Superfamily Trigger factor ribosome-binding domain 0.0575
Family Trigger factor ribosome-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra015895
Sequence length 738
Sequence
MIRAKQISNLSSSARSFFLGGTRSSAADGNSCTSSAEDESSVLRRHRTRPEAVHTGNRVF
TRPSPLHLHVSPPVLPVKPDPANRKIPLPDGTEVSMVDHTLPITSVKASGREHLGEVYTT
SASKDSSERAPVNASPGTKQASNDVSHDLTKTTASGKRKCGYDPSGEMMRVTPAPRHVIE
NVSSILRRFKWGPAAEEALHNSGFKMDAYQANQVLKQIDNYANALGFFYWLKTQPGFKHD
EHTYTTMVGNLGRAKQFGEINNLLNEMVRDGCQPNTVTYNRLIHSYGRANYLKEAMNVFT
QMQEAGCEPDRVTYCTLIDIHAKAGFLDIAMDMYQRMQSAGLSPDTFTYSVIINCLGKSG
HLASAHRLFCEMVGQGCTPSLVTFNIMIALHAKARNYQSALKLYREMKAAGFRPDKVTYS
IVMEVLGHCGFLEEAEGVFTEMERESWVPDEHVYGLLVDLWGKAGNVEKAWRWYQAMLHA
GVRPNVPTCNSLLSTLLRGHRLSEAYNLLQSMVAFGLQSSLQTYTLLLSCCTEARSNFDL
GFCGQLMAVSGHPAHTFLLKMPPAGSDNGQKVRDHVSSFLDYMHSEDRESKRGLIDAVVE
FLHKSGLKEEAGSVWEVAAVKNVYSDALREKSCSYWLINLHVMSEGTAVTALSRTLAWFR
KQMLVSGECPSRIDIVTGWGRRSRVTGSSMVRQAVEELLNVFNFPFFTENGNSGCFVGCG
EPLKNWLSESYVERMHLL
Download sequence
Identical sequences A0A078I5N1 M4DHB8
XP_009106133.1.100322 XP_013652414.1.73403 Bra015895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]