SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra016762 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra016762
Domain Number 1 Region: 181-402
Classification Level Classification E-value
Superfamily HCP-like 0.00000314
Family HCP-like 0.036
Further Details:      
 
Weak hits

Sequence:  Bra016762
Domain Number - Region: 376-471
Classification Level Classification E-value
Superfamily TPR-like 0.00152
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra016762
Sequence length 607
Sequence
MKRFFQTRLLLQTGTLFLSERASSTLSKGKKVSYKERLRSGVVDIKKDDAVELFQSMIVS
RPLPTIIHFSRLFSSLAKTRQYELVLSLSKQMELHGVAHNNYTLNIMINCFSRRRKLGFA
FSAMAKMLKLGYEPDTVTFSTLVNGLCLEGRVSEAVALVDRMVGPNLVTLNTLVNGLCLN
GKVYEAVALVDRMVENGCQPDQFTYGPILNRICKSGNTSLALDLLRKMEDRKVKPEAVTY
NMIIDSLCKDGSLEDALNLFNEMERKGIKANVITYNTLISNFCNAGRWDEAAQLLRDMIT
RGITPNVITFSALIDIFVKEGKHVEAKELYNEMIARGIDPDTVTYNSLIYGLCMEKRLDE
ANQMMDVMVSKGCSPDSVTYNIIINGYCKAKRVEDGLKLFRKMSLREVVSYNTLVQGFCL
SRKIEVAEELFQEMVSRGVDPDTVTYNILVDGLCENGKLEKALEIFEDLHKSEVELDIGI
FNIIIHGMCNGSMIDKAWELFSSLAHKGVKADVKTYTIMIGGLCKKGSLSEADMLFRKME
EDGIAPNECTYNTLIRAHLGGSGVATSVELIEEMKRCGFSADASTMKMVIDMLSDGRLNK
NFLGMLS
Download sequence
Identical sequences M4DJT4
Bra016762 XP_009110633.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]