SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra017628 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra017628
Domain Number 1 Region: 7-130
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.29e-27
Family Synaptotagmin-like (S variant) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra017628
Sequence length 262
Sequence
MSTMSGIQGQILEVTVVGCQKLKDTEWFSRQDPYVVLEYSGTRHRTRTCTDGGKNAVFQE
KFMFTLLEGLRDLKVAVWNSNTLSTDDFIGNATIQLQKVLSQGYDDCTWTLQTKTGRFAG
EVRLILHYAGAKKQNYGSVPSAPPYAPQVPQYSAPPAPSPYSSPPYSGPSPYPQGQYSQP
QSAYPPVSAYPPQPSAYPPPPSTAYPPAPSAYPPGPSAYPPGPSAYPPPPPSSAYPPPPY
PPQPSPYYPQGPYPGQYPPPPY
Download sequence
Identical sequences M4DM96
XP_009138262.1.100322 Bra017628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]