SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra018081 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra018081
Domain Number 1 Region: 339-505
Classification Level Classification E-value
Superfamily TPR-like 6.07e-32
Family Tetratricopeptide repeat (TPR) 0.0042
Further Details:      
 
Weak hits

Sequence:  Bra018081
Domain Number - Region: 181-316
Classification Level Classification E-value
Superfamily TPR-like 0.000569
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Domain Number - Region: 480-559
Classification Level Classification E-value
Superfamily TPR-like 0.00921
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra018081
Sequence length 579
Sequence
MVSKESCRNEIRAAIGQLSERCLHSAAKWAGEQLVGIEQDPSNFTPSNTRFQRGSSSIRR
RFSTNESISTPQPSVGFSQAATPLPEEDEVIDGDLYHLAKSYFNCREYRRASHVLRDQMS
KKSVFLRCYSLYLAGEKRKEEEMIELEGSLGKSDAINRELVSLERELSALKRTGAIDSFG
LYLYGVVLKEKGNETLARASLVESVNSYPWNWNAWSELQSLCTSIEILNSLNLSNHWMKE
FFLASAYQELRMHTESLAKYEYLQGIFSFSNYIQAQTAKAQYSLREFDQVEIMFEDLLRN
DPYRVEDMDLYSNVLYAKEACAALSYLAHKVFLTDKYRPESCCIIGNYYSLKGQHEKAVM
YFRRALKLNKKYLSAWTLMGHEYVEMKNTPAAIDAYRRAVDINPCDYRAWYGLGQAYEMM
GMPFYALHYFRKSIFFLPNDSRLWIAMAKCYQTEQIYMLEEAIKCYKRAVSCTDTEGIAL
NQLAKLHQKLGRDEEAAVYFEKDVERMDSEGLEGPNMLEALVFLATHFKTHKKFEEAEVY
CTRILDYSGPEKEKAKSLLRGIRMEKTGFPSMDMEHFPL
Download sequence
Identical sequences M4DNJ4
Bra018081 XP_009149844.1.100322 XP_013705065.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]