SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra018168 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra018168
Domain Number 1 Region: 335-444
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000531
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra018168
Sequence length 458
Sequence
MDVKVATTTSFHWSGRHAAIPSLSQTLTSSKRRRSRGRGGGSLSSCQTRLKASAFLGTQS
GKLHRSKSCELLEFSTKSKLYPLRRVCSASSGFFSDEEFSAKMQELAIQFKIAGEEEDKV
VVVGNDRRNHRFGNAKLLLHESVPGLASLEAPWMEMVSHSSIERKANRVDLPLSLRMIKR
KLQEEALREARESTYCSIDKAFSSLVFMIEEMHSFALQTREGVVQQVKKDMHASLLWMFQ
RVFSQTPTLMVYVMILLANFTVHSVASNLAIAESPPGSAGTKEDSVLGQGIREEELSLWN
SMVEEADQMQGSPVDRDMRLRLVSPIIARVALDDNANYTRTELFYKIGLAQEPNNPLLLA
NYAQFLYLVSQDYDRAEKCFKKAIESGEADAEAYSKYAIFQWKVRKDLWAAEENFLEAIS
ADPTNSFYAASYANFLWQTGGEETCFPLESSDSPQEIA
Download sequence
Identical sequences M4DNT0
XP_009149933.1.100322 Bra018168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]