SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra018658 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra018658
Domain Number 1 Region: 156-199,490-536
Classification Level Classification E-value
Superfamily TPR-like 0.0000000863
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 2 Region: 352-518
Classification Level Classification E-value
Superfamily TPR-like 0.0000152
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 
Domain Number 3 Region: 57-209
Classification Level Classification E-value
Superfamily TPR-like 0.0000645
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Weak hits

Sequence:  Bra018658
Domain Number - Region: 246-388
Classification Level Classification E-value
Superfamily TPR-like 0.0486
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra018658
Sequence length 687
Sequence
MVKTGLHNTNYALSKLLELCVVSPHFDGLPYAVSVFETIQEPNLLIWNTMLRGHASSSDP
VSALELYLRMVSIGHLPNAYTFPFLLKSCAKSKTFEEGRQIHAQVLKLGCDRDRYVHTSL
ISMYARNGRLEDARKVFDTSSQRDVVSCTALITGYASRGDVRSARKVFDEMPERDVVSWN
AMITGYVENGGYEEALELFKEMMRTNVRPDEGTLVTVLSACAQSGSIELGREIHTMVDDH
HGFGSSLKIVNGLIGLYSKCGDVEIASGLFEGLSCKDVVSWNTLIGGYTHMNLYKEALLL
FQEMLRSGESPNDVTMLSVLPACAHLGAIDIGRWIHVYIDKRLKGVTNETSLRTSLIDMY
AKCGDIEAAHQVFNSMIRRSLSSWNAMIFGFAMHGRANAAFNLFSKMRNNGFEPDDITFV
GLLSACSHSGLLDLGRHIFRSMTHDYNITPKLEHYGCMIDLLGHSGLFKEAEEMINTMSM
EPDGVIWCSLLKACKMHGNLELAESFAQKLIEIEPENSGSYVLLSNIYAAAGRWEDVARI
RAVLNGKGMKKVPGCSSIEIDSVVHEFIIGDKLHPQSIEIYGMLEEMDVLLEEAGFVPDT
SEVLQEMEEEWKEGALRHHSEKLAIAFGLISTKPGTKLTVVKNLRVCRNCHEATKLISKI
YKREIVARDRTRFHHFRDGVCSCCDYW
Download sequence
Identical sequences M4DQ65
Bra018658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]