SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra018705 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra018705
Domain Number 1 Region: 2616-2743
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000151
Family Synaptotagmin-like (S variant) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra018705
Sequence length 4203
Sequence
MFEAHVLHLLRRYLGEYVHGLSTEALRISVWKGDVVLKDLKLKAEALNSLKLPVAVKSGF
VGTITLKVPWKSLGKEPVIVLIDRVFVLAYPAPDGRTVKEEDREKLLETKLQQIEEAESA
TLEARAKSKLGSPPAGNSWLGSLIATIIGNLKVSISNVHIRYEDSTSNPGHPFASGITLA
RLAAVTMDEEGNETFDTSGALDKLRKSLQLERLALYHDSNSSPWEIEKQWDDISTEEWVK
MFEDGIKEKTEHNLKSKWALNRRYLLSPINGSLKYHRLGNQERNNQETPFERASVNINDV
NVTITEEQYHDWIKLVEVVSRYKTYIEISHLRPVVPVSEAPRLWWRFAAQASLQQKRLCY
RFSWDRIHHLCQLRRRYIQLYTNFLQQSSNANNPEMREIERDLDSKVILLWRLIAHAKVE
SVKSKEAAEQKKLKKERAVGSHLIEAEDEPDVDSVAEGSKSVEEGLTKEEWKAINKLLSH
QPDEDMNLYSGKDMQNMTHFLVTVSIGQGAARIVDVNQTEVLCGRFEQLDVTTKFRHRST
QCDVSLRFYGLSAPEGSLAQSVSSERKTNALMASFVKSPIGENIDWRLSATISPCHATIW
TESYDRVLEFVKRSNAVSPTVALETAAALQMKLEEVTRRAQEQLQIVLEEQSRFSLDIDL
DAPKVRIPLRTSGASKCSSHFLLDFGNFTLTTMDTWSEEQRQNLYSRFCISGRDIAAFFT
DCGSDNRGCRLLLEDFTNQPMLSPILEKADNVYSLIERCGMAVIVDQIKVPHPSFPSTRI
SIQVPNIGVHFSPTRYMRIMQLSDILYGAMKTYSQAPVDDTPDGIHPWSPADLASDAKIL
VWKGIGNSVDTWQPCHIVLYGLYPSAFESERSPDYQRYLCMAGRQVFEVPPANVGGSLYC
LAALESSSTWIIEFQGEKKAAWLRGLVQATYQASAPLSGDVLGRSSDGDGDFHEPQIGNS
KAADLVINGALIETKLYLYGKIKDECDEQLEEVLLLKVLATGGKVNMISSESGLTVRTKL
HSLQIKDELQHQQSGSPRYLAYSVLKNEDIQDSPRCDSYDKEMSVRHADDEDAFTDALAE
FLSPTEPGTPDMDMIQCSMLMDSDEHAGLEDTEGGFHEKDTSQGKGLCDEVFYEVQGGEF
SDFVSVVFLTRNSSSPDYNGIDTHMSIRMSKLEFFCSRPTVVALIGFGFDLSAATYVEND
KDTNTVAFEKSDMEKETNDEGGRIEGLLGYGKDRVVFYLNMNVDSVTVFLNKEDGSQLAM
FVQERFVLDIKVHPSSLSIEGTLGNFKLCDKSLDSGNCWSWLCDIRDPGVESLIKFKFNS
YSAGDDDYEGYDYSLSGRLSAVRIVFLYRFVQEVTAYFMGLATPHSEEVIKLVDKVGGFE
WLIQKYEMDGATALKLDLSLDTPIIVVPKDSLSKDYIQLDLGQLEVSNEISWHGCPEKDP
SAVRVDVLHAKILGLNMSVGINGSIGKPMIHEGQGLDIFVRRSLRDVFKKVPTLSIEIKI
DFLHGVMSDKEYDIIVSCTTMNLFEEPKLPPDFRGNSSGPKDQMRMLVDKVNLNSQTIMS
RTVTILAVDINYALLELRNSVNEESPLAHVALEGLWVSYRMTSLSETDLYVWVPKVSVLD
IRPNTKPEIRLMLGSSVDASKQASSESLPFSLNKGSFKRANSRAVLDFDAPCSTMLLMDY
RWRASSQSCVLRVQQPRILAVPDFLLAVGEFFVPALRAITGRDETLDPTNDPITRCSGIV
LSEALYKQIEDVVHLSPCRQLVADSPGVDEYTYDGCGKVISLSEQGEKDLNSGRLEPIII
VGHGKTLRFVNVKIKNGSLLSKCIYLSNDSSCLFSPEDGVDISMLENAKSNSENVLSNAY
KPSDVSDIRQSDLKSGQSFTFEAQVVAPEFTFFDGTKSSLDDSSAVEKLLRVKLDFNFMY
ASKENDIWVRALLKNLVVETGSGLIILDPVDISGGYTSVKEKTNMSLTSTDIYMHLSLSA
LSLLLNLQSQVTGALQSGNAIPLASCTNFHRIWVSPKENGPGNNLTIWRPQAPSNYVILG
DCVTSRAIPPTQAVMAVSNTYGRVRKPIGFNCIGLFSVIQGLKEGNGQHSPDSNECSLWM
PVAPAGYTTMGCVANLGSEPPPDHIVYCLRSDLVSSSSFSECIYTVPSSSLIESGFSIWR
ADNVLGSFYAHSSTEAPSKQYSCGLSHCLLWNPLQLKTYPLCDPSSTNGSQSEQTNDQTG
NSSGWDVLRSISKPSSYHVSTPNFERIWWDKGGDLRRPISIWRPVPRPGFAILGDSITEG
LEPPALGILFKADDSEIAAKPVHFTKAAHIVGKGLDEVFCWFPVAPPGYVSLGCVISKFD
VEPHVDSFCCPRIDLVNQANIYEAPVSRSSSSKSSQCWSIWKVDNQACTFLARSDLKRPP
IRMAFAIGESAKPKTQENVNAEIKLRCFSLTLLDGLHGMMTPLFDTTVTNIKLATHGRPE
AMNAVLVASVAASTFNPQLEAWEPLLEPFDGIFKLETYDTALSQSSRPGKRLRIAATNIL
NLNVSAANLETLGDAVVSWRRQLELEERAAKMKEESSVSRESGDLSAFSALDEDDFQTIV
VENKLGRDIYLKKLEENSDVVVKLCHDENTSVWVPPPRFSNRLNVSDSSREARNYMTVQI
LEAKGLHIVDDGNSHNFFCTLRLVVDSQGAEPQKLFPQSARTKCVKPSTAVVNDLMECTS
KWNELFIFEIPKKGLARLEVEVTNLAAKAGKGEVVGSLSFPVGHGENTLRKVASVRSLYQ
SSDAENISSYTLQRKNVEDIHDNGCLLVSTSYFEKATVPNTLRNMESKDFVDRDTGFWIG
VRPDDSWHSIRSLLPLSVAPKSLQNDFIAMEVSMRNGRKHATFRCLATVANDSDVNLEVS
ISSDQNTSSGASNHNALVVCGSSYVLPWGCLSKDNEQCLHVRPRVDNLSYAWGSCIAVSS
GCGKDQPFVDQGLLTRQQTFKQSSRGSAFALKLNQLEKKDMLFCCQPSTGSKPFWLSVGA
DASVLHTDLNTPVYDWKISVSSPLKLENRLPCPVKFTVSEKTKEGTYLERQHGVVSSRKI
AHVYSADIQRPVYLTLAVHGGWALEKDPIPVLDLSSSDSVSSFWFVHQQSKRRLRVSIER
DVGETGAAPKTIRFFVPYWITNDSYLPLGYRVVEIEPSENAEAGSPCLSRASKSFKKIPA
FSMERRQQRKNVRVLEVIEDTSPLPSMLSPQESAGRSGVVLFPSQKDSYVSPRIGIAVAA
RDSEIYSPGISLLELEKKERIDVNAFCSDASYYKLSAVLNMTSDRTKKNGLILLILQSSL
DGSLPVLFPSQKDSYVSPRIGIAVAARDSEIYSPGISLLELEKKERIDVNAFCSDASYYK
LSAVLNMTSDRTKVIHFQPHTLFINRVGMSICLQQCDCQTEEWINPSDPPKLFGWQSSTR
IELLKLRVKGYRWSTPFSVFSEGIMRVPVGREDGTEQLQLRVQVRSGTKNSRYEVIFRPD
SVSGPYRIENRSMFLPIRYRQVGGVSESWQFLPPNAAASFYWEDLGRRHLFELLVDGNDP
SKSEKYDIDKIGDHPPRSETGPTRPIRVTIVKEDKKNIVRISDWMPAVEPTSSISRRLPA
SSLSDLSGGSQQSQLLASEESEFHVIVELAELGISVIDHAPEEILYMSVQNLFVTYSTGL
GSGLSRYKLRMQGIQVDNQLPLAPMPVLFRPQKTGDNADCILKFSVTLQSNAGLDLRVYP
YIGFHGRENTAFLVNIHEPIIWRIHEMIQQSNLSRLSNSESTAVSVDPFIQIGVLDISEV
RFKVSMAMSPSQRPRGVLGFWSSLMTALGNTENMPVRISGRFNENISMRQSTMINSAIRN
VKKDLLGQPLQLLSGVDILGNASSALGHMSQGIAALSMDKKFIQSRQRQDNKGVEDFGDI
IREGGGALAKGLFRGVTGILTKPLEGAKSSGVEGFVSGFGKGIIGAAAQPVSGVLDLLSK
TTEGANAMRMKIAAAITSDEQLLRRRLPRAVGADSLLRPYNEYRAQGQVILQLAESGSFL
GQVDLFKVRGKFAFTDAYESHFILPKGKVLMITHRRVILLQQPSNIMGQRKFIPAKDACS
IQWDVLWTDLVFMELTEGKKDQPNSPPSRLILYLKSKPNDSKEQVRVVKCSPNTKQALDV
YSAIDTTINLYGQNDSKALVKNKVTRPYSPISESSWAEGGSQQMPASVAPSSTFGTSPTT
SSS
Download sequence
Identical sequences M4DQB2
Bra018705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]