SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra018737 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra018737
Domain Number 1 Region: 63-453
Classification Level Classification E-value
Superfamily Amidase signature (AS) enzymes 2.75e-76
Family Amidase signature (AS) enzymes 0.00015
Further Details:      
 
Domain Number 2 Region: 482-589
Classification Level Classification E-value
Superfamily TPR-like 1.21e-31
Family Tetratricopeptide repeat (TPR) 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra018737
Sequence length 601
Sequence
MQPKRRHVLASRASNLWVLLGLGIAGALLITKKLKKRVREDFGAFIEKLLLLPPPQPSPP
KAPHPLTALSFAVSDLFDVKGYVSGFGHPEWIRTHEAAASTSPVVSVLVEGGATCVGKTV
VGEFAFSISGETKHYDTPTNPAAPARIPGGSCSGAAVAVAANLVDFALGIDTVGGVRVPA
GYCGVLGFRSSQGIVSNAGIIPVSSSLDAVGWFARDPNTLRRVGHVILQLPFAAQRNPRQ
IILADDYLHLSKVPVDRISQVVIKSAEKLFGRQALKHENLEKYFEAKVPSLKEFCRGKAN
GDDAKLTTSMLLANVMQLLQRHEFLQNHGDWINTVNPSIDPAVYSQLCKTPELTDEEIEN
LNAVRNQMRVAIGSLLKDDGILVIPTMPSVPPKLGSKETMSEDYKNRSSSLLCVASISGC
CQVTVPLGKHDKCPVSVSLIARHGGDRFLLDTVQKMYASLQENSSLIINPKSSSINTISQ
EESAEIAKEKGNQAFKEKQWQKAIGMYSEAIKLNDKNGTYYSNRAAAYLELGSYRQAEAD
CTKALTLDKKNIKAYLRRGTAREMLGNFKEAIDDFSYSLVLEPNNKRAALSADRLRKVFL
Q
Download sequence
Identical sequences M4DQE4
Bra018737 XP_018508148.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]