SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra019548 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra019548
Domain Number - Region: 313-457
Classification Level Classification E-value
Superfamily TPR-like 0.000135
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra019548
Sequence length 475
Sequence
MRLAFGSSCYCRAAKNLLFRVTARALSGTTQKNPNNLFSLLHQSPNVNHLRHLHAHLLRT
SNYSNVVLSSKLVLAYSKLNHLFPTSLAVFWHMPHRNIFSWNIIIGEFSRSGFPSQSIDL
FLRMWGESSVRPDDFTLPLVLRACSASREARLGVHVLSLKLGFGVSLFVSSALVIMYVDI
GEILYARKLFDEMLVRDSVLYTAMFGGYVQEGEAVLGLALFREMMCYGFSLDSVVMVSLV
TACGQLGTLKHGKSVHGWCIRRCPCLGLNLGNAVVDMYVKCSKLVYAHRVFVEMPTRDVI
SWSSLVLGYGLDGDVVMSVKLFDEMLEEGIEPNAVTFLGVLSACAHGGLVDKSWLYFRQM
HEYKIVPELKHYASMADCMARAGLLEEAEKFMEEMPVEADEAVMGAVLSGCKVYGNVQVG
ERVAKKLIQLKPGKAGYYVTLAGLYTAAGRFDEAESLRQWMKDKQISKVPGCSSI
Download sequence
Identical sequences M4DSQ5
XP_009150190.1.100322 Bra019548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]