SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra019757 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra019757
Domain Number 1 Region: 40-91
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000753
Family PHD domain 0.0097
Further Details:      
 
Domain Number 2 Region: 138-202
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000031
Family PHD domain 0.0096
Further Details:      
 
Domain Number 3 Region: 211-243
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000797
Family PHD domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra019757
Sequence length 287
Sequence
MAVLGNSLLELSKTFSTEQLKKFYTRESKPNPNAENIRNVCVYDNCKLCGEKAAVTDCLA
CDHCEDMYHVSCAHPGGKGMSTGSWYCINCTANGIGSPHENCVVCERMKTDSRRVDKSTE
CKEDSNESEENSSCNINHGGHKVEVKRDSELCRTCGTKVVENGRFITCDHPFCPHKYYHI
RCLTAKLVKLHGGARWYCSSCLCRNCLTDKDDAYHIYCMKPPRASVPDEEWFCKTCNAAS
QKVRKVRKAYEKKMGTLQKQNGNLKSNGDSVGGGVDMLLNAADTLKD
Download sequence
Identical sequences M4DTB4
Bra019757 XP_009148792.2.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]