SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra019805 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra019805
Domain Number - Region: 337-469
Classification Level Classification E-value
Superfamily TPR-like 0.00387
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra019805
Sequence length 517
Sequence
MHQTLGAVRLAYRSRIAHLVKSGMIDNAVQVFDEMRHSSYRVFSVDYNRFIGVLVKDSRF
ELAEAIYRDMTPMGFSLIPFTYSRFISGLCKVKNFDLIDALMRDMETLGYVPDIWAFNIY
LDLLCRERKVGFAVQTFCCMVRRGREPDVVSYTILINGLFRAGKVTDAVEIWNEMIRRGI
RPDNRACAALVVGLCHARKVDLAYEMVADEIKSARVKLSTVVYNALISGFCRAGRIEKAE
ALKSFMSKSGCEPDVVTYNVLLNFYYDNNMLKKAEGVMSEMVKSGIQPDAYSYNQLLKRH
CRVSHPDKCYSFMAKEMEPRGLCDVVSYSTLIETFCRASNTRKAYKIFEEMREKGVVMNV
VTYTSLIKAFLREGNSSVAKKLLDQMTELGLSPDRIFYTTILEHLCKSGNLDKAYGVFKD
MIEHGIAPDVISYNALISALCRSCRVTEAMKLFEDMQSKECCPDELTFKFIIGGLIRENK
VSAAYKIWDQMMDKGFTLDRDVSDTLIKASCSVSADA
Download sequence
Identical sequences M4DTG2
Bra019805 XP_009148549.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]